Clone Name | rbastl33c08 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | BAK1_ARATH (Q94F62) BRASSINOSTEROID INSENSITIVE 1-associated rec... | 37 | 0.015 | 2 | SRD34_CAEEL (Q19975) Serpentine receptor class delta-34 (Protein... | 30 | 2.3 | 3 | ENV_GALV (P21415) Env polyprotein precursor [Contains: Coat prot... | 29 | 5.2 | 4 | YBD1_SCHPO (O42925) Hypothetical protein C16C6.01c in chromosome II | 28 | 8.8 |
---|
>BAK1_ARATH (Q94F62) BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1| precursor (EC 2.7.11.1) (BRI1-associated receptor kinase 1) (Somatic embryogenesis receptor-like kinase 3) Length = 615 Score = 37.4 bits (85), Expect = 0.015 Identities = 16/28 (57%), Positives = 21/28 (75%) Frame = -1 Query: 413 MLNVALLCTNAAPTLRPKMSNAVSLLEG 330 ++ VALLCT ++P RPKMS V +LEG Sbjct: 538 LIQVALLCTQSSPMERPKMSEVVRMLEG 565
>SRD34_CAEEL (Q19975) Serpentine receptor class delta-34 (Protein srd-34)| Length = 339 Score = 30.0 bits (66), Expect = 2.3 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 134 FDVFQICTPVRITRAMPLCLFWQYNVATNIKTPNSTKN 21 FD FQ+ + A+P LF++Y TNI N TKN Sbjct: 100 FDFFQLVFDAS-SFAIPATLFYKYTKVTNINMKNITKN 136
>ENV_GALV (P21415) Env polyprotein precursor [Contains: Coat protein GP70;| Spike protein p15E] Length = 667 Score = 28.9 bits (63), Expect = 5.2 Identities = 16/42 (38%), Positives = 21/42 (50%), Gaps = 2/42 (4%) Frame = +2 Query: 143 SQNVSGYHLHLKMTSH--WCCYMMLVPLCSGSHLDFPRSFCV 262 S N SG H +L ++H W C L P S S + R FC+ Sbjct: 419 SINSSGDHQYLLPSNHSWWACSTGLTPCLSTSVFNQTRDFCI 460
>YBD1_SCHPO (O42925) Hypothetical protein C16C6.01c in chromosome II| Length = 473 Score = 28.1 bits (61), Expect = 8.8 Identities = 10/15 (66%), Positives = 13/15 (86%) Frame = +3 Query: 15 TCILSRIRCFYVSSY 59 TC+L + RCFYV+SY Sbjct: 184 TCVLVQSRCFYVNSY 198 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 56,581,634 Number of Sequences: 219361 Number of extensions: 1041255 Number of successful extensions: 2193 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2154 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2193 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2286875994 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)