Clone Name | rbastl33b01 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | OAR_DROME (P22270) Tyramine/octopamine receptor precursor (Tyr/O... | 31 | 1.3 | 2 | AGRN_RAT (P25304) Agrin precursor | 29 | 4.8 |
---|
>OAR_DROME (P22270) Tyramine/octopamine receptor precursor (Tyr/Oct-Dro)| Length = 601 Score = 31.2 bits (69), Expect = 1.3 Identities = 28/86 (32%), Positives = 38/86 (44%), Gaps = 2/86 (2%) Frame = -3 Query: 385 IWIFCTVLCSRESLHERADLRLFSGCTQRLANLC-YSLDMYRRV-QPVNLTCKFTLCVHD 212 +W+ C VLC CT + NLC +LD Y + P+N K T+ Sbjct: 184 LWLTCDVLC----------------CTSSILNLCAIALDRYWAITDPINYAQKRTV---- 223 Query: 211 TRILSGRSVLIYLSRVTLASLKCSTP 134 GR VL+ +S V L SL S+P Sbjct: 224 -----GR-VLLLISGVWLLSLLISSP 243
>AGRN_RAT (P25304) Agrin precursor| Length = 1959 Score = 29.3 bits (64), Expect = 4.8 Identities = 12/29 (41%), Positives = 21/29 (72%) Frame = +3 Query: 45 TVSAECELIQSKCNKEKKKRVIRDN*HGS 131 T S ECEL +++CN++++ R++R GS Sbjct: 111 TYSNECELQRAQCNQQRRIRLLRQGPCGS 139 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 56,489,948 Number of Sequences: 219361 Number of extensions: 1005302 Number of successful extensions: 2135 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2115 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2135 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2793557952 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)