Clone Name | rbastl33a12 |
---|---|
Clone Library Name | barley_pub |
>RFX1_HUMAN (P22670) MHC class II regulatory factor RFX1 (RFX) (Enhancer factor| C) (EF-C) Length = 979 Score = 29.3 bits (64), Expect = 2.4 Identities = 17/47 (36%), Positives = 26/47 (55%), Gaps = 6/47 (12%) Frame = +3 Query: 153 DSATSVSATRP------RLHVRKLQQGLPVPGARRVLVYRPQKPRPG 275 +S++S +A P +L V +QQ +PV R V+ PQ P+PG Sbjct: 214 NSSSSKTAGAPTGTVPQQLQVHGVQQSVPVTQERSVVQATPQAPKPG 260
>IAP2_NPVOP (O10324) Probable apoptosis inhibitor 2 (IAP-2)| Length = 236 Score = 28.5 bits (62), Expect = 4.1 Identities = 21/75 (28%), Positives = 31/75 (41%), Gaps = 10/75 (13%) Frame = +1 Query: 106 AKRSTRHKLRYNCVKLI--LLRPSQLQDRGYT--------YASCSKAFQYLEHDGFWCIA 255 A+R RH CV I L+ L+ R + + S ++ L GF+C+ Sbjct: 59 ARRVKRHTYSDTCVSAINALVANESLRKRSFASFKWARRQFGSRAREVDMLSRRGFYCVG 118 Query: 256 LRSHAPGLCIVSTSC 300 R G C V T+C Sbjct: 119 KRLRCAG-CKVVTTC 132
>SGS3_DROYA (P13728) Salivary glue protein Sgs-3 precursor| Length = 263 Score = 27.7 bits (60), Expect = 7.0 Identities = 16/48 (33%), Positives = 24/48 (50%) Frame = +3 Query: 24 PTTRGKC*KETMFTTTNTLRQSTSWAHSKEVYTTQITLQLR*TDSATS 167 PTTR + T TTT T R +T+ ++ TT T + T + T+ Sbjct: 109 PTTRSTTTRHTTTTTTTTRRPTTTTTTTRRPTTTTTTTRRPTTTTTTT 156
>CTR1_OCTVU (Q7YW31) Cephalotocin receptor 1 (OT/VP superfamily peptide| receptor-1) (OC/CE-R 1) Length = 397 Score = 27.3 bits (59), Expect = 9.1 Identities = 9/22 (40%), Positives = 10/22 (45%) Frame = +1 Query: 286 VSTSCCCFFCWGPASTAVDWLA 351 +S CCF CW P W A Sbjct: 298 LSVVACCFICWSPFFVCQMWAA 319
>NOTC2_RAT (Q9QW30) Neurogenic locus notch homolog protein 2 precursor (Notch| 2) [Contains: Notch 2 extracellular truncation; Notch 2 intracellular domain] Length = 2471 Score = 27.3 bits (59), Expect = 9.1 Identities = 20/77 (25%), Positives = 34/77 (44%), Gaps = 1/77 (1%) Frame = +1 Query: 157 LLRPSQLQDRGYTYASCSKAFQYLEHDGFWCIALRSHAPGLCIVSTSCCCFFCWGPASTA 336 LL+P+ Q+ G +C+ + G+ C+ + + C + C F P ST Sbjct: 303 LLQPNACQNGG----TCTN-----RNGGYGCVCVNGWSGDDCSENIDDCAFASCTPGSTC 353 Query: 337 VDWLAS-RCIWK*SSAG 384 +D +AS C+ AG Sbjct: 354 IDRVASFSCLCPEGKAG 370
>BNK_DROME (P40794) Protein bottleneck| Length = 303 Score = 27.3 bits (59), Expect = 9.1 Identities = 12/37 (32%), Positives = 21/37 (56%) Frame = +3 Query: 84 QSTSWAHSKEVYTTQITLQLR*TDSATSVSATRPRLH 194 Q T + K +T+Q+ ++L T+ +S RP+LH Sbjct: 48 QPTITSTPKPRFTSQLAVELAKTEPGNGISPLRPKLH 84
>POLG_KUNJM (P14335) Genome polyprotein [Contains: Capsid protein C (Core| protein); Envelope protein M (Matrix protein); Major envelope protein E; Nonstructural protein 1 (NS1); Nonstructural protein 2A (NS2A); Flavivirin protease NS2B regulatory subunit; Length = 3433 Score = 27.3 bits (59), Expect = 9.1 Identities = 11/23 (47%), Positives = 17/23 (73%) Frame = +1 Query: 160 LRPSQLQDRGYTYASCSKAFQYL 228 ++ +LQ +G TY CSKAF++L Sbjct: 580 VKMEKLQLKGTTYGVCSKAFRFL 602
>EPCR_BOVIN (Q28105) Endothelial protein C receptor precursor (Endothelial cell| protein C receptor) (Activated protein C receptor) (APC receptor) Length = 241 Score = 27.3 bits (59), Expect = 9.1 Identities = 16/49 (32%), Positives = 24/49 (48%) Frame = -2 Query: 338 TAVLAGPQQKKQQQLVETMQSPGAWLLRAIHQNPSCSRYWKALLQLAYV 192 T VL GP + Q ++ +Q P +W L I+ N RY + + L V Sbjct: 57 THVLEGPGRNVSIQQLQPLQEPDSWALTKIYLN----RYLEEFVGLVQV 101 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 49,714,029 Number of Sequences: 219361 Number of extensions: 879709 Number of successful extensions: 2522 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 2436 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2520 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 1386249648 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)