Clone Name | rbastl33a06 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | HAP1_HAEIN (P44596) Adhesion and penetration protein precursor (... | 34 | 0.22 | 2 | STE3_YEAST (P06783) Pheromone a factor receptor | 30 | 2.4 | 3 | BORG4_MOUSE (Q9JM96) Cdc42 effector protein 4 (Binder of Rho GTP... | 28 | 9.1 |
---|
>HAP1_HAEIN (P44596) Adhesion and penetration protein precursor (EC 3.4.21.-)| Length = 1409 Score = 33.9 bits (76), Expect = 0.22 Identities = 24/81 (29%), Positives = 36/81 (44%), Gaps = 2/81 (2%) Frame = +3 Query: 102 GVQPSCLSTDC-RGEKAAMELCLTIVLRSTR*TNYFP*KWAQ-KINNRNRATVKVINALA 275 GV P+ +T C R + + C T+ L T+ N P IN N ATV + Sbjct: 705 GVVPNXQNTICTRSDWTGLTTCKTVNLTDTKVINSIPITQINGSINLTNNATVNIHGLAK 764 Query: 276 TRTHVTAPDHSSSSMKQNSEE 338 +VT DHS ++ N+ + Sbjct: 765 LNGNVTLIDHSQFTLSNNATQ 785
>STE3_YEAST (P06783) Pheromone a factor receptor| Length = 470 Score = 30.4 bits (67), Expect = 2.4 Identities = 11/27 (40%), Positives = 19/27 (70%) Frame = +2 Query: 41 RIFNYCLSRFSSALNLLTAAWRTTVLF 121 ++F Y ++R++ NLL+ W TTVL+ Sbjct: 135 QVFRYGIARYNGCQNLLSPTWITTVLY 161
>BORG4_MOUSE (Q9JM96) Cdc42 effector protein 4 (Binder of Rho GTPases 4)| Length = 349 Score = 28.5 bits (62), Expect = 9.1 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = -3 Query: 355 APSRRGSSEFCFIDEEE 305 AP R+ EFCF+DEEE Sbjct: 327 APPRQPDKEFCFMDEEE 343 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 62,896,861 Number of Sequences: 219361 Number of extensions: 1156628 Number of successful extensions: 2488 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2389 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2486 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3072927439 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)