Clone Name | rbastl32h05 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | R1AB_IBVBC (Q91QT2) Replicase polyprotein 1ab (pp1ab) (ORF1ab po... | 28 | 4.5 | 2 | R1AB_IBVB (P27920) Replicase polyprotein 1ab (pp1ab) (ORF1ab pol... | 28 | 4.5 | 3 | T2R46_PAPHA (Q646G0) Taste receptor type 2 member 46 (T2R46) | 28 | 5.9 | 4 | SUT1_STYHA (P53391) High affinity sulphate transporter 1 | 27 | 10.0 |
---|
>R1AB_IBVBC (Q91QT2) Replicase polyprotein 1ab (pp1ab) (ORF1ab polyprotein)| [Includes: Replicase polyprotein 1a (pp1a) (ORF1a)] [Contains: p87; p195 (EC 3.4.22.-) (Papain-like proteinase) (PL-PRO); Peptide HD2 (p41); 3C-like proteinase (EC 3.4.22.-) (3CL- Length = 6629 Score = 28.5 bits (62), Expect = 4.5 Identities = 13/24 (54%), Positives = 15/24 (62%) Frame = -2 Query: 120 NPTVVAASFLFNAVKQFLVDLEPP 49 NP + ASFL A Q VDL+PP Sbjct: 3719 NPNLKVASFLNEAGNQIYVDLDPP 3742
>R1AB_IBVB (P27920) Replicase polyprotein 1ab (pp1ab) (ORF1ab polyprotein)| [Includes: Replicase polyprotein 1a (pp1a) (ORF1a)] [Contains: p87; p195 (EC 3.4.22.-) (Papain-like proteinase) (PL-PRO); Peptide HD2 (p41); 3C-like proteinase (EC 3.4.22.-) (3CL-P Length = 6629 Score = 28.5 bits (62), Expect = 4.5 Identities = 13/24 (54%), Positives = 15/24 (62%) Frame = -2 Query: 120 NPTVVAASFLFNAVKQFLVDLEPP 49 NP + ASFL A Q VDL+PP Sbjct: 3719 NPNLKVASFLNEAGNQIYVDLDPP 3742
>T2R46_PAPHA (Q646G0) Taste receptor type 2 member 46 (T2R46)| Length = 309 Score = 28.1 bits (61), Expect = 5.9 Identities = 13/37 (35%), Positives = 22/37 (59%) Frame = -2 Query: 201 LAFHLVKAQGISINYSIWLCVSWFSRWNPTVVAASFL 91 LAFH V+ + S Y++W+ + FS W T ++ +L Sbjct: 73 LAFHSVEVR--STAYNVWVVTNHFSNWLSTSLSMFYL 107
>SUT1_STYHA (P53391) High affinity sulphate transporter 1| Length = 667 Score = 27.3 bits (59), Expect = 10.0 Identities = 14/61 (22%), Positives = 29/61 (47%), Gaps = 1/61 (1%) Frame = -2 Query: 183 KAQGISINYSIWLCVSWFSRWNPTVVAASFL-FNAVKQFLVDLEPPYFLISSLTSIVHAI 7 K IS+ S+W V W ++ SFL F + +++ F +S+++ ++ I Sbjct: 249 KTDIISVMRSVWTHVHHGWNWETILIGLSFLIFLLITKYIAKKNKKLFWVSAISPMISVI 308 Query: 6 I 4 + Sbjct: 309 V 309 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 39,223,628 Number of Sequences: 219361 Number of extensions: 592626 Number of successful extensions: 1374 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1359 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1374 length of database: 80,573,946 effective HSP length: 78 effective length of database: 63,463,788 effective search space used: 1523130912 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)