Clone Name | rbastl32g12 |
---|---|
Clone Library Name | barley_pub |
>URED_SYNY3 (P73047) Urease accessory protein ureD| Length = 270 Score = 29.6 bits (65), Expect = 2.0 Identities = 13/42 (30%), Positives = 22/42 (52%) Frame = -2 Query: 288 AASVDERRQWHAQSWFRYESFGHRAKLSRELI*KLSKKERLY 163 A++V+ W A W RY+ GHR ++ L+ K +R + Sbjct: 4 ASTVNPSAPWQANLWLRYDRPGHRTRMVECLVQAPLKVQRSF 45
>SYK2_MYCTU (P94974) Putative lysyl-tRNA synthetase 2 (EC 6.1.1.6)| (Lysine--tRNA ligase 2) (LysRS 2) Length = 1172 Score = 28.5 bits (62), Expect = 4.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +1 Query: 61 VLPLQRRNAVHKGHRP 108 VLP RRN VH GH P Sbjct: 628 VLPFSRRNRVHTGHHP 643
>SYK2_MYCBO (Q7VEV7) Putative lysyl-tRNA synthetase 2 (EC 6.1.1.6)| (Lysine--tRNA ligase 2) (LysRS 2) Length = 1172 Score = 28.5 bits (62), Expect = 4.5 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +1 Query: 61 VLPLQRRNAVHKGHRP 108 VLP RRN VH GH P Sbjct: 628 VLPFSRRNRVHTGHHP 643
>Y1356_MYCBO (P64806) Hypothetical protein Mb1356| Length = 98 Score = 28.1 bits (61), Expect = 5.9 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = -2 Query: 297 ETPAASVDERRQWHAQSW 244 + P A VD+RR WH W Sbjct: 68 DLPQAGVDDRRHWHTPCW 85
>Y1322_MYCTU (P64805) Hypothetical protein Rv1322/MT1363.1| Length = 98 Score = 28.1 bits (61), Expect = 5.9 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = -2 Query: 297 ETPAASVDERRQWHAQSW 244 + P A VD+RR WH W Sbjct: 68 DLPQAGVDDRRHWHTPCW 85
>N4BM_HUMAN (O95298) NADH-ubiquinone oxidoreductase subunit B14.5b (EC 1.6.5.3)| (EC 1.6.99.3) (Complex I-B14.5b) (CI-B14.5b) Length = 119 Score = 27.3 bits (59), Expect = 10.0 Identities = 9/17 (52%), Positives = 15/17 (88%) Frame = -3 Query: 185 LVRKRDYIYAIRRRELY 135 LV++ DY+YA+R RE++ Sbjct: 74 LVKREDYLYAVRDREMF 90 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 42,411,572 Number of Sequences: 219361 Number of extensions: 712671 Number of successful extensions: 1961 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1914 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1961 length of database: 80,573,946 effective HSP length: 78 effective length of database: 63,463,788 effective search space used: 1523130912 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)