Clone Name | rbastl32g10 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | PHCY2_HOMAM (Q6KF81) Pseudohemocyanin-2 precursor (Fragment) | 28 | 4.3 | 2 | PHCY1_HOMAM (Q6KF82) Pseudohemocyanin-1 precursor (Fragment) | 28 | 4.3 | 3 | DPOLZ_HUMAN (O60673) DNA polymerase zeta catalytic subunit (EC 2... | 28 | 5.7 |
---|
>PHCY2_HOMAM (Q6KF81) Pseudohemocyanin-2 precursor (Fragment)| Length = 681 Score = 28.5 bits (62), Expect = 4.3 Identities = 15/52 (28%), Positives = 27/52 (51%), Gaps = 2/52 (3%) Frame = -1 Query: 331 LLVPEKWSGAINWCIC--KNLSAQVFNYVIYTLISQASISRITLLQPRYSIM 182 LL + W AI + K ++ + + Y +YT I + +++ +L P Y IM Sbjct: 112 LLQCQDWPTAIGNAVYFRKMMNEETYVYALYTAIKHSPLTKHVVLPPLYEIM 163
>PHCY1_HOMAM (Q6KF82) Pseudohemocyanin-1 precursor (Fragment)| Length = 684 Score = 28.5 bits (62), Expect = 4.3 Identities = 15/52 (28%), Positives = 27/52 (51%), Gaps = 2/52 (3%) Frame = -1 Query: 331 LLVPEKWSGAINWCIC--KNLSAQVFNYVIYTLISQASISRITLLQPRYSIM 182 LL + W AI + K ++ + + Y +YT I + +++ +L P Y IM Sbjct: 114 LLQCQDWPTAIGNAVYFRKMMNEETYVYALYTAIKHSPLTKHVVLPPLYEIM 165
>DPOLZ_HUMAN (O60673) DNA polymerase zeta catalytic subunit (EC 2.7.7.7) (hREV3)| Length = 3130 Score = 28.1 bits (61), Expect = 5.7 Identities = 18/56 (32%), Positives = 27/56 (48%), Gaps = 6/56 (10%) Frame = +1 Query: 67 LNGKLRPDSSVQTIAGVCSYSFLS------LQ*PCSKQHHSIINS*LNTWAGEG*C 216 LNG RP S V+ + + +FL + PCS+ ++ S +NT A G C Sbjct: 2139 LNGDDRPSSPVEELPSLAFENFLKPIKDGIQKSPCSEPQEPLVISPINTRARTGKC 2194 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 49,670,229 Number of Sequences: 219361 Number of extensions: 875870 Number of successful extensions: 1416 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1413 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1416 length of database: 80,573,946 effective HSP length: 87 effective length of database: 61,489,539 effective search space used: 1475748936 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)