| Clone Name | rbastl32f11 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ADDG_HUMAN (Q9UEY8) Gamma-adducin (Adducin-like protein 70) | 28 | 4.1 | 2 | NINJ1_HUMAN (Q92982) Ninjurin-1 (Nerve injury-induced protein 1) | 28 | 4.1 | 3 | YO83_CAEEL (P34619) Hypothetical protein ZK1236.3 | 28 | 4.1 | 4 | US17_HCMVA (P09716) Hypothetical protein HVLF1 | 28 | 5.3 | 5 | IF2_ZYMMO (Q5NQ27) Translation initiation factor IF-2 | 28 | 6.9 | 6 | US12_HCMVA (P09721) Hypothetical protein HVLF6 | 28 | 6.9 | 7 | BRAB_PSEAE (P19072) Branched chain amino acid transport system I... | 27 | 9.0 |
|---|
>ADDG_HUMAN (Q9UEY8) Gamma-adducin (Adducin-like protein 70)| Length = 706 Score = 28.5 bits (62), Expect = 4.1 Identities = 25/104 (24%), Positives = 44/104 (42%) Frame = +2 Query: 41 KYYSPQQHAGKIRDLSRKNNHKRL*PPGFSMPLATARSPKTKLS*KEPQEKSNPXXXXXX 220 KY + +Q K R L+ N + ++ P S T SP+TK++ + ++ S Sbjct: 426 KYMAQRQQREKTRWLNSPNTYMKVNVPEESRNGET--SPRTKITWMKAEDSSKVSGGTPI 483 Query: 221 XRENNTQDLNILTDPNSITISISTRHANRRSRISKPGDQPLELA 352 E+ Q + + T+PN + + R + G Q LA Sbjct: 484 KIEDPNQFVPLNTNPNEVLEKRNKIREQNRYDLKTAGPQSQLLA 527
>NINJ1_HUMAN (Q92982) Ninjurin-1 (Nerve injury-induced protein 1)| Length = 152 Score = 28.5 bits (62), Expect = 4.1 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = +3 Query: 297 MPTGVPGSANLETSRWSWR 353 +P G PGS + +RW WR Sbjct: 14 LPPGTPGSPDASPARWGWR 32
>YO83_CAEEL (P34619) Hypothetical protein ZK1236.3| Length = 1000 Score = 28.5 bits (62), Expect = 4.1 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = +3 Query: 69 EKSGTCQEKTTIKGCSRQALVCPSRRPDP 155 EKSG TIK + L+C SR+ DP Sbjct: 805 EKSGRLNVSNTIKAINEYRLLCNSRQADP 833
>US17_HCMVA (P09716) Hypothetical protein HVLF1| Length = 293 Score = 28.1 bits (61), Expect = 5.3 Identities = 25/73 (34%), Positives = 36/73 (49%), Gaps = 7/73 (9%) Frame = -1 Query: 393 SVIFSLLHG*EVAGASSNGWSPGLLILERLLACLVDI-------DIVIEFGSVSMLRSCV 235 ++ +LLHG G+ ++ SPGLL + +L L I ++ F S L +CV Sbjct: 89 TICLALLHGKRDEGSFTSPPSPGLLTIYSVLTTLSVIVASACSSSTLVTF---SGLLACV 145 Query: 234 LFSLVCVWCHVGL 196 LFSL C GL Sbjct: 146 LFSLCS--CVTGL 156
>IF2_ZYMMO (Q5NQ27) Translation initiation factor IF-2| Length = 989 Score = 27.7 bits (60), Expect = 6.9 Identities = 17/45 (37%), Positives = 27/45 (60%), Gaps = 5/45 (11%) Frame = -1 Query: 363 EVAGASSNGWSPGLLILE-----RLLACLVDIDIVIEFGSVSMLR 244 EV A +G + GLL+LE +L A ++ D++I GS++ LR Sbjct: 902 EVFSAGKHGRAAGLLVLEGYIRQKLRARVLRNDVIIYNGSIASLR 946
>US12_HCMVA (P09721) Hypothetical protein HVLF6| Length = 281 Score = 27.7 bits (60), Expect = 6.9 Identities = 14/44 (31%), Positives = 24/44 (54%), Gaps = 3/44 (6%) Frame = -1 Query: 330 PGLLILERLLACLVDIDIV---IEFGSVSMLRSCVLFSLVCVWC 208 PG L+L + L I + + F ++++ VL S++CVWC Sbjct: 113 PGTLMLVMVYTTLTTISVSTIGLCFDRTVVIQAYVLSSMLCVWC 156
>BRAB_PSEAE (P19072) Branched chain amino acid transport system II carrier| protein (LIV-II) Length = 437 Score = 27.3 bits (59), Expect = 9.0 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = -1 Query: 267 FGSVSMLRSCVLFSLVCVWCHVGLLFSCGSF*ESLV 160 FG L V+ +L C+ VGL+ +CG F L+ Sbjct: 274 FGVSGSLLLAVVITLACLTTAVGLITACGEFFSDLL 309 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 52,359,935 Number of Sequences: 219361 Number of extensions: 924477 Number of successful extensions: 2202 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 2165 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2202 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 1375720320 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)