Clone Name | rbastl32f07 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | JHD3C_MOUSE (Q8VCD7) JmjC domain-containing histone demethylatio... | 29 | 2.3 | 2 | ADO1_ARATH (Q94BT6) Adagio protein 1 (Protein ZEITLUPE) (LOV kel... | 28 | 6.8 | 3 | TF_BOVIN (P30931) Tissue factor precursor (TF) (Coagulation fact... | 27 | 8.9 | 4 | DNAJ2_PROAC (Q6A662) Chaperone protein dnaJ 2 | 27 | 8.9 |
---|
>JHD3C_MOUSE (Q8VCD7) JmjC domain-containing histone demethylation protein 3C| (EC 1.14.11.-) (Jumonji domain-containing protein 2C) Length = 1054 Score = 29.3 bits (64), Expect = 2.3 Identities = 14/34 (41%), Positives = 20/34 (58%) Frame = -3 Query: 404 LFKSHLFHVEFLRECLDLDDEVRETASWTQGMIN 303 L K + E L E L +D+EV ET SW + +I+ Sbjct: 584 LVKQQVASDEELPEVLSIDEEVEETESWAKPLIH 617
>ADO1_ARATH (Q94BT6) Adagio protein 1 (Protein ZEITLUPE) (LOV kelch protein 1)| (Flavin-binding kelch repeat F-box protein 1-like protein 2) (FKF1-like protein 2) (F-box only protein 2b) (FBX2b) (Clock-associated PAS protein ZTL) Length = 609 Score = 27.7 bits (60), Expect = 6.8 Identities = 15/45 (33%), Positives = 24/45 (53%) Frame = -3 Query: 269 TLSCYGGCLVLLMHQTEFGFGSYEQKGTKVYVASVSQ*EPCRRCL 135 TLS YGG +L+ G + + + V+ +S+ EPC RC+ Sbjct: 454 TLSVYGGRKILMFGGLAKS-GPLKFRSSDVFTMDLSEEEPCWRCV 497
>TF_BOVIN (P30931) Tissue factor precursor (TF) (Coagulation factor III)| (CD142 antigen) Length = 292 Score = 27.3 bits (59), Expect = 8.9 Identities = 15/38 (39%), Positives = 19/38 (50%), Gaps = 4/38 (10%) Frame = -1 Query: 103 RCASH----STAVGFTS*TAKLIIIVFYSVCVACLHSC 2 +C SH ST + F T L+II+F V LH C Sbjct: 237 KCTSHEKVLSTELFFIIGTVMLVIIIFIVVLSVSLHKC 274
>DNAJ2_PROAC (Q6A662) Chaperone protein dnaJ 2| Length = 380 Score = 27.3 bits (59), Expect = 8.9 Identities = 16/41 (39%), Positives = 22/41 (53%) Frame = -3 Query: 191 GTKVYVASVSQ*EPCRRCLGWFYYFQSVKSLCVTFDGSGVY 69 GT V + VSQ PC+ C G +V +C T GSG++ Sbjct: 151 GTTVTMDMVSQ-APCQACRGTGARAGTVPRVCSTCQGSGMH 190 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 58,778,976 Number of Sequences: 219361 Number of extensions: 1131800 Number of successful extensions: 2344 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2308 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2344 length of database: 80,573,946 effective HSP length: 111 effective length of database: 56,224,875 effective search space used: 1349397000 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)