Clone Name | rbastl32f06 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | FANCC_MOUSE (P50652) Fanconi anemia group C protein homolog (Pro... | 28 | 6.7 | 2 | ENGC2_VIBVY (Q7MGA2) Probable GTPase engC protein 2 (EC 3.6.1.-) | 28 | 8.8 | 3 | ENGC2_VIBVU (Q8D4Q0) Probable GTPase engC protein 2 (EC 3.6.1.-) | 28 | 8.8 |
---|
>FANCC_MOUSE (P50652) Fanconi anemia group C protein homolog (Protein FACC)| Length = 591 Score = 28.5 bits (62), Expect = 6.7 Identities = 11/35 (31%), Positives = 22/35 (62%), Gaps = 2/35 (5%) Frame = -3 Query: 349 CWSSV--AIHETQRKALSCLCPVLPSSPRMRRQNG 251 CW+ + +I+E+Q+ + CLC ++ PR ++G Sbjct: 75 CWNPLIFSIYESQKIVIWCLCCLMNKEPRTSAESG 109
>ENGC2_VIBVY (Q7MGA2) Probable GTPase engC protein 2 (EC 3.6.1.-)| Length = 353 Score = 28.1 bits (61), Expect = 8.8 Identities = 14/37 (37%), Positives = 23/37 (62%) Frame = +1 Query: 292 DTDRTGLSSVFHGSRQNSNKGR*TTTSDSFHLVCDAS 402 +T +TG G R++ +KGR TTT+ S H++ D + Sbjct: 215 ETQQTG------GIREDDSKGRHTTTARSVHMIPDGA 245
>ENGC2_VIBVU (Q8D4Q0) Probable GTPase engC protein 2 (EC 3.6.1.-)| Length = 349 Score = 28.1 bits (61), Expect = 8.8 Identities = 14/37 (37%), Positives = 23/37 (62%) Frame = +1 Query: 292 DTDRTGLSSVFHGSRQNSNKGR*TTTSDSFHLVCDAS 402 +T +TG G R++ +KGR TTT+ S H++ D + Sbjct: 211 ETQQTG------GIREDDSKGRHTTTARSVHMIPDGA 241 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 59,576,917 Number of Sequences: 219361 Number of extensions: 1155499 Number of successful extensions: 2757 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2714 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2757 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2278320915 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)