Clone Name | rbastl32f02 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | FUSB_BURCE (P24127) Fusaric acid resistance protein fusB | 33 | 0.44 | 2 | FANCA_HUMAN (O15360) Fanconi anemia group A protein (Protein FACA) | 32 | 0.97 | 3 | CN065_HUMAN (Q8N9R9) Protein C14orf65 | 31 | 1.3 | 4 | TRPB_PSESY (P34817) Tryptophan synthase beta chain (EC 4.2.1.20) | 31 | 1.7 | 5 | VG12_SHV21 (P24915) Hypothetical gene 12 protein | 28 | 8.2 |
---|
>FUSB_BURCE (P24127) Fusaric acid resistance protein fusB| Length = 142 Score = 32.7 bits (73), Expect = 0.44 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -1 Query: 448 WRSPCSGRCA*PTPRA 401 WRSPC RCA P PRA Sbjct: 110 WRSPCGSRCAPPAPRA 125
>FANCA_HUMAN (O15360) Fanconi anemia group A protein (Protein FACA)| Length = 1455 Score = 31.6 bits (70), Expect = 0.97 Identities = 15/39 (38%), Positives = 16/39 (41%) Frame = +2 Query: 314 FVLNVCLTTCLLRSPWAATWSSGRRAALPCPWRRSCAPP 430 F+L C T C L A W L C WRR C P Sbjct: 1154 FILAKCQTKCPLILTSALVWWPSLEPVLLCRWRRHCQSP 1192
>CN065_HUMAN (Q8N9R9) Protein C14orf65| Length = 162 Score = 31.2 bits (69), Expect = 1.3 Identities = 16/39 (41%), Positives = 19/39 (48%), Gaps = 7/39 (17%) Frame = +2 Query: 356 PWAA----TWSS---GRRAALPCPWRRSCAPPTAGTSPC 451 PW + TW S A PC WR S +PP + SPC Sbjct: 99 PWRSGCPHTWGSVLSHPMPAAPCFWRSSPSPPVSAMSPC 137
>TRPB_PSESY (P34817) Tryptophan synthase beta chain (EC 4.2.1.20)| Length = 408 Score = 30.8 bits (68), Expect = 1.7 Identities = 17/55 (30%), Positives = 26/55 (47%), Gaps = 5/55 (9%) Frame = -2 Query: 447 GEVPAVGGAHDLRHGQGRAALRPEDH-----VAAQGDRSKHVVRHTFKTNRYVLH 298 G +PA+ AH L RA P+DH ++ +GD+ V H +T + H Sbjct: 354 GIIPALESAHALAEVFKRAPTLPKDHLMVVNLSGRGDKDMQTVMHHMETTKQEKH 408
>VG12_SHV21 (P24915) Hypothetical gene 12 protein| Length = 169 Score = 28.5 bits (62), Expect = 8.2 Identities = 16/59 (27%), Positives = 26/59 (44%) Frame = -2 Query: 261 SC*C*KRQMHCAAVESCMCFSAFHSFFCLDNICCKMNVMLYCKSIGRATARRVVPVLQE 85 +C C R H CF + H FC K +M+ C S+ + ++ PVL++ Sbjct: 22 ACDCPSRVHHTCLQSHIQCFKSSHCTFCEK----KYKIMVMCNSLKKCSS----PVLEQ 72 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 66,882,396 Number of Sequences: 219361 Number of extensions: 1311815 Number of successful extensions: 3237 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 3166 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3237 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2793557952 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)