Clone Name | rbastl32f01 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | FRIZ4_DROME (Q9NBW1) Protein frizzled-4 precursor (dFz4) | 30 | 3.4 | 2 | TRI38_HUMAN (O00635) Tripartite motif protein 38 (RING finger pr... | 29 | 7.6 | 3 | NADD_TREPA (O83723) Probable nicotinate-nucleotide adenylyltrans... | 28 | 9.9 |
---|
>FRIZ4_DROME (Q9NBW1) Protein frizzled-4 precursor (dFz4)| Length = 705 Score = 30.0 bits (66), Expect = 3.4 Identities = 18/51 (35%), Positives = 26/51 (50%), Gaps = 1/51 (1%) Frame = +3 Query: 225 SPVHEIGSPYDSDLNSRVACHPRLRGFHIVIVKAPCYNCER-ARDNRAHTM 374 +PVH IG + R+ CHP L+GF P +C++ R+N TM Sbjct: 111 APVHAIGPCRSLCESVRIRCHPVLQGFG--FPWPPALDCDKFPRENNHETM 159
>TRI38_HUMAN (O00635) Tripartite motif protein 38 (RING finger protein 15) (Zinc| finger protein RoRet) Length = 465 Score = 28.9 bits (63), Expect = 7.6 Identities = 16/60 (26%), Positives = 29/60 (48%), Gaps = 5/60 (8%) Frame = +3 Query: 228 PVHEIGSPYDS--DLNSRVACHPRLRGFHIVIV---KAPCYNCERARDNRAHTMATAEQV 392 P ++GS ++ + + ++C FH+ + C+ CERA ++ HT A E V Sbjct: 73 PNKQLGSLIEALKETDQEMSCEEHGEQFHLFCEDEGQLICWRCERAPQHKGHTTALVEDV 132
>NADD_TREPA (O83723) Probable nicotinate-nucleotide adenylyltransferase (EC| 2.7.7.18) (Deamido-NAD(+) pyrophosphorylase) (Deamido-NAD(+) diphosphorylase) (Nicotinate mononucleotide adenylyltransferase) (NaMN adenylyltransferase) Length = 204 Score = 28.5 bits (62), Expect = 9.9 Identities = 20/68 (29%), Positives = 27/68 (39%) Frame = +3 Query: 219 FVSPVHEIGSPYDSDLNSRVACHPRLRGFHIVIVKAPCYNCERARDNRAHTMATAEQVTH 398 FVSP E + H R+R H+ I P ++ E R TAE V H Sbjct: 39 FVSPFKE--------KEGSASAHDRVRMLHLAIGTTPYFSVEECEIRRGGISYTAETVQH 90 Query: 399 APSLKHKY 422 ++ KY Sbjct: 91 ---VREKY 95 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 68,423,177 Number of Sequences: 219361 Number of extensions: 1349894 Number of successful extensions: 2660 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2622 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2660 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3362826254 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)