| Clone Name | rbastl32e05 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SPSE_BACSU (P39625) Spore coat polysaccharide biosynthesis prote... | 32 | 0.80 | 2 | FLGE_BORBU (Q44767) Flagellar hook protein flgE | 30 | 4.0 | 3 | IF2_LEGPL (Q5WT36) Translation initiation factor IF-2 | 30 | 4.0 | 4 | PUR4_CAEEL (Q19311) Probable phosphoribosylformylglycinamidine s... | 29 | 6.8 | 5 | STON1_HUMAN (Q9Y6Q2) Stonin-1 (Stoned B-like factor) | 28 | 8.9 |
|---|
>SPSE_BACSU (P39625) Spore coat polysaccharide biosynthesis protein spsE| Length = 373 Score = 32.0 bits (71), Expect = 0.80 Identities = 17/66 (25%), Positives = 28/66 (42%) Frame = +2 Query: 44 HCILYLPSQNWQKLGN*VPSQSSAVRLEITLLSMFPTGASCWNEKEEHPVDMPCLAKKTS 223 HC+ P+ P + S + + L + FP +++ EHP + PC A + Sbjct: 180 HCVAKYPA----------PPEYSNLSVIPMLAAAFPEAVIGFSDHSEHPTEAPCAAVRLG 229 Query: 224 TKFCEK 241 K EK Sbjct: 230 AKLIEK 235
>FLGE_BORBU (Q44767) Flagellar hook protein flgE| Length = 442 Score = 29.6 bits (65), Expect = 4.0 Identities = 21/73 (28%), Positives = 35/73 (47%), Gaps = 2/73 (2%) Frame = +3 Query: 183 NIQSICLALQKKPQQSSVRRLI*SLNLDFKLLLAHEYCNRLTRGRRILV*QRSMLSSFGT 362 +I+ + + + K S + + + NLD +L L E N R V +S+ SFG Sbjct: 154 DIEDLIIPIGDKEGAKSTKNVTFACNLDKRLPLIQEGANPADIARGTWVVNKSLYDSFGN 213 Query: 363 SSSIKCR--QDLN 395 S ++ R +DLN Sbjct: 214 VSVLELRVVKDLN 226
>IF2_LEGPL (Q5WT36) Translation initiation factor IF-2| Length = 868 Score = 29.6 bits (65), Expect = 4.0 Identities = 18/41 (43%), Positives = 21/41 (51%) Frame = +2 Query: 125 EITLLSMFPTGASCWNEKEEHPVDMPCLAKKTSTKFCEKIN 247 EIT++S S E EEHPV P A + K EKIN Sbjct: 125 EITVVSEVSADTSELKETEEHPVIEPVAALDETVKEEEKIN 165
>PUR4_CAEEL (Q19311) Probable phosphoribosylformylglycinamidine synthase (EC| 6.3.5.3) (FGAM synthase) (FGAMS) (Formylglycinamide ribotide amidotransferase) (FGARAT) (Formylglycinamide ribotide synthetase) Length = 1343 Score = 28.9 bits (63), Expect = 6.8 Identities = 22/79 (27%), Positives = 33/79 (41%) Frame = +2 Query: 59 LPSQNWQKLGN*VPSQSSAVRLEITLLSMFPTGASCWNEKEEHPVDMPCLAKKTSTKFCE 238 L S NW+KL +TLLS P S W E + HP + + Sbjct: 50 LISSNWEKL--------------VTLLSHSPFETSVWKESQLHP------------EHGK 83 Query: 239 KINLKLKSGLQTPACS*IL 295 I + ++ ++T AC+ IL Sbjct: 84 NIEIGPRTAVKTAACTNIL 102
>STON1_HUMAN (Q9Y6Q2) Stonin-1 (Stoned B-like factor)| Length = 735 Score = 28.5 bits (62), Expect = 8.9 Identities = 17/44 (38%), Positives = 22/44 (50%) Frame = +1 Query: 91 LSSFSIICSQARNNASFHVPNRRVMLE*KGGTSSRYALPCKKNL 222 L S S+ C A NAS VP+ + K G S +P KKN+ Sbjct: 245 LRSLSMHCLCAEENASSFVPHTLFRSQPKSGWSFMLRIPEKKNM 288 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 64,732,943 Number of Sequences: 219361 Number of extensions: 1251548 Number of successful extensions: 3418 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 3350 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3418 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3014947676 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)