Clone Name | rbastl32d09 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | VPR_HV2G1 (P18046) VPR protein (R ORF protein) | 30 | 2.4 | 2 | PSD3_CAEEL (Q04908) 26S proteasome non-ATPase regulatory subunit... | 28 | 7.1 | 3 | MASS1_MOUSE (Q8VHN7) Monogenic audiogenic seizure susceptibility... | 28 | 9.2 |
---|
>VPR_HV2G1 (P18046) VPR protein (R ORF protein)| Length = 105 Score = 30.0 bits (66), Expect = 2.4 Identities = 16/52 (30%), Positives = 28/52 (53%), Gaps = 2/52 (3%) Frame = +3 Query: 99 TNYTPESGKAKEVTGGDLKFFFLCMVHRKTLRSF--RMIIHMGSGSNSRNGN 248 T + PE G + GGD L + + L+ F R++I +G+ +SR+G+ Sbjct: 6 TEFPPEDGTPRRELGGDWVIRILGEIKEEALKHFDPRLLIALGNYIHSRHGD 57
>PSD3_CAEEL (Q04908) 26S proteasome non-ATPase regulatory subunit 3 (26S| proteasome regulatory subunit rpn-3) Length = 504 Score = 28.5 bits (62), Expect = 7.1 Identities = 19/51 (37%), Positives = 26/51 (50%) Frame = +3 Query: 159 FFLCMVHRKTLRSFRMIIHMGSGSNSRNGNYQL*INHQKEASLICWLLLHY 311 +FLC+++ R R+ H G NSR L + +A LICWLL Y Sbjct: 180 YFLCVIYE---REGRLFDHQGF-LNSRLRTATLRNFSESQAVLICWLLRCY 226
>MASS1_MOUSE (Q8VHN7) Monogenic audiogenic seizure susceptibility protein 1| precursor (Very large G-protein coupled receptor 1) (Neurepin) Length = 6298 Score = 28.1 bits (61), Expect = 9.2 Identities = 14/34 (41%), Positives = 21/34 (61%) Frame = +2 Query: 176 TQENVTIFQDDHPHGVGVQLKKWQLSTIDKSSKG 277 T N+TI ++D+PHG+ ++ LS K SKG Sbjct: 875 TLVNITILKNDYPHGI-IEFVSDGLSASIKESKG 907 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 61,649,307 Number of Sequences: 219361 Number of extensions: 1158766 Number of successful extensions: 2166 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2146 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2165 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2395157885 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)