Clone Name | rbastl32d06 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | PPK_BACHD (Q9KD27) Polyphosphate kinase (EC 2.7.4.1) (Polyphosph... | 29 | 3.9 | 2 | SSB_WIGBR (Q8D254) Single-stranded DNA-binding protein (SSB) (He... | 29 | 5.1 | 3 | LIPP_PIG (P00591) Pancreatic triacylglycerol lipase (EC 3.1.1.3)... | 28 | 6.7 |
---|
>PPK_BACHD (Q9KD27) Polyphosphate kinase (EC 2.7.4.1) (Polyphosphoric acid| kinase) (ATP-polyphosphate phosphotransferase) Length = 705 Score = 29.3 bits (64), Expect = 3.9 Identities = 15/70 (21%), Positives = 32/70 (45%) Frame = +1 Query: 13 IPSIHPYKIRQFTPFPVHERSQRDPLQPTRSEIRMGRKRRRILHGFFTGTNATDSLSFLV 192 + S+ P++I + P+HE RD L+ E++ + + G + L L+ Sbjct: 232 VKSVSPFRITRNADLPIHEEGARDLLREIEKELKKRKWGAAVRLEMQEGLMDPNVLKLLL 291 Query: 193 NLRHIFRQNV 222 ++ I + +V Sbjct: 292 DVLEIHKNDV 301
>SSB_WIGBR (Q8D254) Single-stranded DNA-binding protein (SSB)| (Helix-destabilizing protein) Length = 163 Score = 28.9 bits (63), Expect = 5.1 Identities = 19/52 (36%), Positives = 25/52 (48%), Gaps = 1/52 (1%) Frame = +3 Query: 33 QDQAIHTISSP*TVTERSITTYQV-RDKNGEEEKENTTWLFYRDERHRFIVF 185 QD + I + +T S+ T + RDKN E KE T W HR I+F Sbjct: 17 QDPEVRYIPNGNAITNLSLATSENWRDKNTGESKEKTEW-------HRVILF 61
>LIPP_PIG (P00591) Pancreatic triacylglycerol lipase (EC 3.1.1.3) (Pancreatic| lipase) (PL) Length = 450 Score = 28.5 bits (62), Expect = 6.7 Identities = 13/23 (56%), Positives = 14/23 (60%) Frame = +1 Query: 82 DPLQPTRSEIRMGRKRRRILHGF 150 DP T S RM RK R I+HGF Sbjct: 56 DPSTITNSNFRMDRKTRFIIHGF 78 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 49,240,200 Number of Sequences: 219361 Number of extensions: 780727 Number of successful extensions: 2063 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2012 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2063 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2278320915 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)