| Clone Name | rbastl32d05 |
|---|---|
| Clone Library Name | barley_pub |
>ARGC_XYLFT (Q87EL1) N-acetyl-gamma-glutamyl-phosphate reductase (EC 1.2.1.38)| (AGPR) (N-acetyl-glutamate semialdehyde dehydrogenase) (NAGSA dehydrogenase) Length = 327 Score = 30.0 bits (66), Expect = 1.7 Identities = 11/31 (35%), Positives = 19/31 (61%) Frame = +2 Query: 20 VSLT*NLWLNQMFHRQHTFRIYTTDFGSQPI 112 ++LT NLWL + R+H +Y T + + P+ Sbjct: 219 ITLTANLWLQRPLTREHIKTLYATRYANDPL 249
>GLND_NITWN (Q3SWE0) [Protein-PII] uridylyltransferase (EC 2.7.7.59) (PII| uridylyl-transferase) (Uridylyl-removing enzyme) (UTase) Length = 925 Score = 29.3 bits (64), Expect = 2.9 Identities = 15/37 (40%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Frame = +1 Query: 4 EDRIHRVLDMKPVVKPNVS*ATY-LQDLHNRFWFSTY 111 E+R HR + +V+PNV L+DLH FW + Y Sbjct: 222 EERHHRAGQSRYLVEPNVKDGKGGLRDLHTLFWIAKY 258
>ARGC_XYLFA (Q9PEM6) N-acetyl-gamma-glutamyl-phosphate reductase (EC 1.2.1.38)| (AGPR) (N-acetyl-glutamate semialdehyde dehydrogenase) (NAGSA dehydrogenase) Length = 333 Score = 29.3 bits (64), Expect = 2.9 Identities = 11/31 (35%), Positives = 19/31 (61%) Frame = +2 Query: 20 VSLT*NLWLNQMFHRQHTFRIYTTDFGSQPI 112 ++LT NLWL + R+H +Y T + + P+ Sbjct: 219 ITLTANLWLQRPLTREHIKILYATRYANDPL 249
>YHCT_BACSU (P54604) Hypothetical RNA pseudouridine synthase yhcT (EC 5.4.99.-)| (RNA-uridine isomerase) (RNA pseudouridylate synthase) Length = 302 Score = 28.9 bits (63), Expect = 3.8 Identities = 14/32 (43%), Positives = 19/32 (59%) Frame = -1 Query: 172 VLLQRLLVNRMGRVYTVIKFNRLRTKIGCVNP 77 +L Q+L + R YT I +LRTK G +NP Sbjct: 156 ILDQQLEKKTLKRTYTAIAEGKLRTKKGTINP 187
>GALE1_PEA (Q43070) UDP-glucose 4-epimerase (EC 5.1.3.2) (Galactowaldenase)| (UDP-galactose 4-epimerase) Length = 350 Score = 27.7 bits (60), Expect = 8.4 Identities = 12/22 (54%), Positives = 16/22 (72%) Frame = -3 Query: 209 GTQRGSTILKMVCALAKTIGKQ 144 GT RGS++L+MV A K GK+ Sbjct: 272 GTGRGSSVLEMVAAFEKASGKK 293 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 35,081,538 Number of Sequences: 219361 Number of extensions: 591648 Number of successful extensions: 983 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 976 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 983 length of database: 80,573,946 effective HSP length: 51 effective length of database: 69,386,535 effective search space used: 1665276840 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)