Clone Name | rbastl32d03 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | GOP1_CAEEL (P46578) Hypothetical protein gop-1 | 30 | 4.0 | 2 | LINES_DROME (Q9V4Z9) Protein Lines | 29 | 6.8 | 3 | SH2D3_MOUSE (Q9QZS8) SH2 domain-containing protein 3C (SH2 domai... | 28 | 8.9 |
---|
>GOP1_CAEEL (P46578) Hypothetical protein gop-1| Length = 892 Score = 29.6 bits (65), Expect = 4.0 Identities = 11/33 (33%), Positives = 21/33 (63%) Frame = -3 Query: 350 DQRLIHGEVQAPP*GVEARQPVLTSSYVSDVHM 252 D +++H V+ P ++ R PVLT+ ++ D H+ Sbjct: 755 DSKVLHVVVEGQPSRIKKRHPVLTAKFIFDDHI 787
>LINES_DROME (Q9V4Z9) Protein Lines| Length = 858 Score = 28.9 bits (63), Expect = 6.8 Identities = 22/102 (21%), Positives = 42/102 (41%), Gaps = 5/102 (4%) Frame = +1 Query: 169 EVPSHIQYGKKVLPPSRN-----IKIFFKRNLYICTSET*EEVSTGCLASTPHGGACTSP 333 ++ I+ G K LPP + + N ++C+S + + ST + T+P Sbjct: 40 KIEQQIKVGSKALPPQPPHPPDILDLDANSNSHLCSSLSSSSSHSLSTPSTANNSPTTTP 99 Query: 334 CMSR*SASAWQADSMAPWR*NSVVSSAHRARHHSC*TCGGLP 459 C SR ++ A ++ P ++ + S + H LP Sbjct: 100 CSSRAASYAQLLHNILPQNGDTDLHSQPESAHDEVDRAAKLP 141
>SH2D3_MOUSE (Q9QZS8) SH2 domain-containing protein 3C (SH2 domain-containing| Eph receptor-binding protein 1) (Cas/HEF1-associated signal transducer) Length = 854 Score = 28.5 bits (62), Expect = 8.9 Identities = 13/28 (46%), Positives = 20/28 (71%) Frame = -1 Query: 451 LRKSNTSDDELDELSSPLSFISKAPSNP 368 +R S D++ +L SPLS IS++PS+P Sbjct: 385 IRNCALSMDQIPDLHSPLSPISESPSSP 412 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 66,388,994 Number of Sequences: 219361 Number of extensions: 1345365 Number of successful extensions: 2617 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2575 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2617 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 3026354448 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)