Clone Name | rbastl32c03 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | FBX44_MOUSE (Q8BK26) F-box only protein 44 (F-box only protein 6a) | 29 | 2.5 | 2 | S14L3_HUMAN (Q9UDX4) SEC14-like protein 3 (Tocopherol-associated... | 28 | 5.7 | 3 | LAMA3_MOUSE (Q61789) Laminin alpha-3 chain precursor (Nicein alp... | 27 | 9.7 |
---|
>FBX44_MOUSE (Q8BK26) F-box only protein 44 (F-box only protein 6a)| Length = 255 Score = 29.3 bits (64), Expect = 2.5 Identities = 10/43 (23%), Positives = 21/43 (48%) Frame = -1 Query: 287 NVKGSSQDCTVNVFAHRKVAKLIIRANPVTDLWQHFSSSILVW 159 N+ ++ + +F H +L++R PV LW+ + +W Sbjct: 5 NINELPENILLELFIHIPARQLLLRCRPVCSLWRDLIDLVTLW 47
>S14L3_HUMAN (Q9UDX4) SEC14-like protein 3 (Tocopherol-associated protein 2)| Length = 400 Score = 28.1 bits (61), Expect = 5.7 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = +3 Query: 147 TNVLPYQNGRAEMLPKIGNRVCSD 218 T+VLP Q A M+P+ GN CS+ Sbjct: 334 TDVLPSQRYNAHMVPEDGNLTCSE 357
>LAMA3_MOUSE (Q61789) Laminin alpha-3 chain precursor (Nicein alpha subunit)| Length = 3333 Score = 27.3 bits (59), Expect = 9.7 Identities = 16/47 (34%), Positives = 21/47 (44%), Gaps = 4/47 (8%) Frame = +2 Query: 8 QNGGHFLQNSQCPACN-PDSQIFH---RLLDGK*RGWKQKKKSHGLE 136 Q GH +Q C CN DS+ H +DG R W+ S G + Sbjct: 88 QGSGHTIQGQFCDYCNSEDSRKAHPASHAIDGSERWWQSPPLSSGTQ 134 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 47,577,252 Number of Sequences: 219361 Number of extensions: 794359 Number of successful extensions: 1689 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1658 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1689 length of database: 80,573,946 effective HSP length: 87 effective length of database: 61,489,539 effective search space used: 1475748936 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)