Clone Name | rbastl32a10 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | YNQ6_SCHPO (Q9UUD4) Hypothetical protein C19C2.06c in chromosome II | 32 | 0.80 |
---|
>YNQ6_SCHPO (Q9UUD4) Hypothetical protein C19C2.06c in chromosome II| Length = 145 Score = 31.6 bits (70), Expect = 0.80 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = +1 Query: 196 RKRASILGAALHLFWCCFSYPLMCLRATNCLIPCF 300 R+ + L + L W FS +MC A +C +PCF Sbjct: 70 RRGIASLSVCVALHWIAFSCSVMCHFAWSCALPCF 104 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 51,145,422 Number of Sequences: 219361 Number of extensions: 822961 Number of successful extensions: 1570 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1539 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1569 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2286875994 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)