Clone Name | rbastl32a08 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | MOAA_ERWCT (Q6D3C7) Molybdenum cofactor biosynthesis protein A | 29 | 3.2 |
---|
>MOAA_ERWCT (Q6D3C7) Molybdenum cofactor biosynthesis protein A| Length = 329 Score = 29.3 bits (64), Expect = 3.2 Identities = 16/36 (44%), Positives = 20/36 (55%), Gaps = 5/36 (13%) Frame = +3 Query: 15 QMSITQVCTFLLLPCSQDGY-----DPH*FLSYNLI 107 ++SIT VC F C DGY +PH FLS + I Sbjct: 17 RLSITDVCNFRCTYCLPDGYQANGTNPHRFLSLDEI 52 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 17,360,918 Number of Sequences: 219361 Number of extensions: 186698 Number of successful extensions: 376 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 375 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 376 length of database: 80,573,946 effective HSP length: 13 effective length of database: 77,722,253 effective search space used: 1865334072 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)