Clone Name | rbastl32a06 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | TOP2_ASFB7 (Q00942) DNA topoisomerase 2 (EC 5.99.1.3) (DNA topoi... | 29 | 5.3 | 2 | TOP2_ASFM2 (P34203) DNA topoisomerase 2 (EC 5.99.1.3) (DNA topoi... | 28 | 9.1 |
---|
>TOP2_ASFB7 (Q00942) DNA topoisomerase 2 (EC 5.99.1.3) (DNA topoisomerase II)| Length = 1192 Score = 29.3 bits (64), Expect = 5.3 Identities = 19/76 (25%), Positives = 35/76 (46%), Gaps = 1/76 (1%) Frame = -2 Query: 230 LCRPDVCTKGVPVFVVRLQAMVCISSVSCDVRSLFMCKATRVQILNRWVLFFI*KQRSGN 51 L + ++CT VP+ + Q++ + + C + KA ++ + R + F+ Sbjct: 659 LRKRELCTGVVPLTETQTQSIHSVRRIPCSLHLQVDTKAYKLDAIERQIPNFLDGMTRAR 718 Query: 50 EKICA-GLCCFISEMR 6 KI A G+ CF S R Sbjct: 719 RKILAGGVKCFASNNR 734
>TOP2_ASFM2 (P34203) DNA topoisomerase 2 (EC 5.99.1.3) (DNA topoisomerase II)| Length = 1191 Score = 28.5 bits (62), Expect = 9.1 Identities = 20/76 (26%), Positives = 34/76 (44%), Gaps = 1/76 (1%) Frame = -2 Query: 230 LCRPDVCTKGVPVFVVRLQAMVCISSVSCDVRSLFMCKATRVQILNRWVLFFI*KQRSGN 51 L + ++CT VP+ + Q++ + C + KA ++ + R + F+ Sbjct: 658 LRKRELCTGVVPLTETQTQSIHSDRQIPCSLHLQVDTKAYKLDAIERQIPNFLDGMTRAR 717 Query: 50 EKICA-GLCCFISEMR 6 KI A GL CF S R Sbjct: 718 RKILAGGLKCFASNNR 733 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 76,352,794 Number of Sequences: 219361 Number of extensions: 1663569 Number of successful extensions: 3754 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3677 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3754 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3072927439 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)