Clone Name | rbastl31h11 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | L2AM_DROLE (O96569) Alpha-methyldopa hypersensitive protein (EC ... | 29 | 4.1 | 2 | ISP5_SCHPO (P40901) Sexual differentiation process putative amin... | 28 | 5.4 | 3 | YCEL_BACST (Q45401) UPF0249 protein in cel operon | 28 | 9.1 |
---|
>L2AM_DROLE (O96569) Alpha-methyldopa hypersensitive protein (EC 4.1.1.-)| (Fragment) Length = 439 Score = 28.9 bits (63), Expect = 4.1 Identities = 10/32 (31%), Positives = 20/32 (62%) Frame = -1 Query: 100 PSTMCFPTVYGCNISKG*SFISLAWVISYICT 5 P+++ +P++ G ++ G S I +W+ S CT Sbjct: 10 PTSVSYPSIVGEMLASGFSIIGFSWICSPACT 41
>ISP5_SCHPO (P40901) Sexual differentiation process putative amino-acid| permease isp5 Length = 580 Score = 28.5 bits (62), Expect = 5.4 Identities = 18/42 (42%), Positives = 21/42 (50%), Gaps = 5/42 (11%) Frame = -2 Query: 111 GAHPLLPCAS-----PLYMVVTLARAEVSFPWRGSFHTYVLR 1 GA +L C S L V +L V+FP GSFHTY R Sbjct: 113 GAASVLICYSLVGSMVLMTVYSLGELAVAFPINGSFHTYGTR 154
>YCEL_BACST (Q45401) UPF0249 protein in cel operon| Length = 245 Score = 27.7 bits (60), Expect = 9.1 Identities = 15/39 (38%), Positives = 20/39 (51%) Frame = -2 Query: 141 LSRCHRWLYLGAHPLLPCASPLYMVVTLARAEVSFPWRG 25 L++ H L +G H +L C PL V +L FP RG Sbjct: 49 LAKDHPELGVGIHFVLTCGRPLADVPSLVNENGEFPRRG 87 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 23,285,966 Number of Sequences: 219361 Number of extensions: 328420 Number of successful extensions: 650 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 644 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 650 length of database: 80,573,946 effective HSP length: 22 effective length of database: 75,748,004 effective search space used: 1817952096 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)