Clone Name | rbastl31h08 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | CH60_CLOBO (Q8KJ24) 60 kDa chaperonin (Protein Cpn60) (groEL pro... | 29 | 2.3 | 2 | POLG_HCVSA (O91936) Genome polyprotein [Contains: Core protein p... | 27 | 8.8 |
---|
>CH60_CLOBO (Q8KJ24) 60 kDa chaperonin (Protein Cpn60) (groEL protein)| Length = 543 Score = 29.3 bits (64), Expect = 2.3 Identities = 17/53 (32%), Positives = 30/53 (56%) Frame = +3 Query: 39 LNATMQSLNVLITDK*VSVSTPHYRQILEQMTLQSMKLEQMLHPIQGDCLITI 197 + A +++ +L+TDK +S + ILEQ+ Q KL + I+G+ L T+ Sbjct: 209 MEAVLENPYILLTDKKIS-NIQEILPILEQIVQQGKKLLIIAEDIEGEALATL 260
>POLG_HCVSA (O91936) Genome polyprotein [Contains: Core protein p21 (Capsid| protein C) (p21); Core protein p19; Envelope glycoprotein E1 (gp32) (gp35); Envelope glycoprotein E2 (NS1) (gp68) (gp70); p7; Protease NS2-3 (EC 3.4.22.-) (p23); Serine protease/N Length = 3013 Score = 27.3 bits (59), Expect = 8.8 Identities = 13/60 (21%), Positives = 32/60 (53%) Frame = +3 Query: 15 NNSIVYIILNATMQSLNVLITDK*VSVSTPHYRQILEQMTLQSMKLEQMLHPIQGDCLIT 194 ++++VY + + +T + V HYR+++++M + K++ L P++ C +T Sbjct: 2455 HHNLVYSTSSRSAGQRQKKVTFDRLQVLDDHYREVVDEMKRLASKVKARLLPLEEACGLT 2514 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 38,322,234 Number of Sequences: 219361 Number of extensions: 530535 Number of successful extensions: 1464 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1452 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1464 length of database: 80,573,946 effective HSP length: 112 effective length of database: 56,005,514 effective search space used: 1344132336 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)