| Clone Name | rbastl31g07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PANX1_PONPY (Q5REE3) Pannexin-1 | 31 | 1.3 | 2 | PANX1_HUMAN (Q96RD7) Pannexin-1 | 31 | 1.3 | 3 | PANX1_RAT (P60570) Pannexin-1 | 30 | 2.2 | 4 | PANX1_MOUSE (Q9JIP4) Pannexin-1 | 30 | 2.2 | 5 | EXOC2_CAEEL (Q22706) Probable exocyst complex component 2 (Exocy... | 30 | 3.7 |
|---|
>PANX1_PONPY (Q5REE3) Pannexin-1| Length = 426 Score = 31.2 bits (69), Expect = 1.3 Identities = 23/69 (33%), Positives = 31/69 (44%), Gaps = 1/69 (1%) Frame = +2 Query: 245 QLSRFQPSSFLWNPKAMMTVLCWMKILQMG*VAVEA-LLGCRLHCSYF*HQPDQCLLSES 421 Q+S F PSSF W A + CW + Q + E+ L LH + LL + Sbjct: 63 QISCFSPSSFSWRQAAFVDSYCWAAVQQKNSLQSESGNLPLWLHKFF-----PYILLLFA 117 Query: 422 VQLYSRPLF 448 + LY PLF Sbjct: 118 ILLYLPPLF 126
>PANX1_HUMAN (Q96RD7) Pannexin-1| Length = 426 Score = 31.2 bits (69), Expect = 1.3 Identities = 23/69 (33%), Positives = 31/69 (44%), Gaps = 1/69 (1%) Frame = +2 Query: 245 QLSRFQPSSFLWNPKAMMTVLCWMKILQMG*VAVEA-LLGCRLHCSYF*HQPDQCLLSES 421 Q+S F PSSF W A + CW + Q + E+ L LH + LL + Sbjct: 63 QISCFSPSSFSWRQAAFVDSYCWAAVQQKNSLQSESGNLPLWLHKFF-----PYILLLFA 117 Query: 422 VQLYSRPLF 448 + LY PLF Sbjct: 118 ILLYLPPLF 126
>PANX1_RAT (P60570) Pannexin-1| Length = 426 Score = 30.4 bits (67), Expect = 2.2 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = +2 Query: 245 QLSRFQPSSFLWNPKAMMTVLCWMKILQ 328 Q+S F PSSF W A + CW + Q Sbjct: 63 QISCFSPSSFSWRQAAFVDSYCWAAVQQ 90
>PANX1_MOUSE (Q9JIP4) Pannexin-1| Length = 426 Score = 30.4 bits (67), Expect = 2.2 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = +2 Query: 245 QLSRFQPSSFLWNPKAMMTVLCWMKILQ 328 Q+S F PSSF W A + CW + Q Sbjct: 63 QISCFSPSSFSWRQAAFVDSYCWAAVQQ 90
>EXOC2_CAEEL (Q22706) Probable exocyst complex component 2 (Exocyst complex| component Sec5) Length = 884 Score = 29.6 bits (65), Expect = 3.7 Identities = 15/44 (34%), Positives = 25/44 (56%) Frame = +3 Query: 312 G*RFCKWVKWPLRLSSAAVFTALIFSTSLINASFQNLFSCTHAR 443 G +F KW P +S + + +L + SLI++ +N FS TH + Sbjct: 495 GDQFAKWPTVPADISRSNLQLSLKTTRSLISSLLENQFSLTHVQ 538 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 58,304,226 Number of Sequences: 219361 Number of extensions: 990928 Number of successful extensions: 2687 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2565 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2686 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2793557952 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)