Clone Name | rbastl31g06 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | Y436_MYCPN (P75342) Hypothetical lipoprotein MG307 homolog precu... | 28 | 7.3 | 2 | CD2AP_HUMAN (Q9Y5K6) CD2-associated protein (Cas ligand with mul... | 28 | 7.3 | 3 | FAEB_NEUCR (Q9HGR3) Feruloyl esterase B precursor (EC 3.1.1.73) ... | 27 | 9.6 | 4 | UBIE_RHIME (Q92SK7) Ubiquinone/menaquinone biosynthesis methyltr... | 27 | 9.6 |
---|
>Y436_MYCPN (P75342) Hypothetical lipoprotein MG307 homolog precursor| (A05_orf1244) Length = 1244 Score = 27.7 bits (60), Expect = 7.3 Identities = 12/42 (28%), Positives = 21/42 (50%) Frame = +2 Query: 116 DITTIRKKKVQYQLPNKNASRSQ*KQRADSKALPDYAFSFFS 241 D T I + +Y P++ + +++ K P YAF FF+ Sbjct: 222 DPTLISQVNYKYSAPSQGLGQIYNREKLKDKLTPSYAFPFFA 263
>CD2AP_HUMAN (Q9Y5K6) CD2-associated protein (Cas ligand with multiple SH3| domains) (Adapter protein CMS) Length = 639 Score = 27.7 bits (60), Expect = 7.3 Identities = 19/64 (29%), Positives = 32/64 (50%), Gaps = 3/64 (4%) Frame = +1 Query: 130 PQKKGAVSTSKQKCQ*VPI---ETESRLKSTARLRI*FLLSLTDDPQLLEKGGELPHALL 300 P+K + + K Q V I +TE ++K+ R F T++ +L K GE+ H + Sbjct: 241 PEKPLILQSLGPKTQSVEITKTDTEGKIKAKEYCRTLFAYEGTNEDELTFKEGEIIHLIS 300 Query: 301 LDTG 312 +TG Sbjct: 301 KETG 304
>FAEB_NEUCR (Q9HGR3) Feruloyl esterase B precursor (EC 3.1.1.73) (Ferulic acid| esterase B) (FAEB) Length = 292 Score = 27.3 bits (59), Expect = 9.6 Identities = 13/32 (40%), Positives = 21/32 (65%), Gaps = 2/32 (6%) Frame = +3 Query: 42 NIIYKRKAI--VRNWSFIVPFEFSINVTSPPS 131 N++Y R A+ ++ WS ++ EFS NV+ PS Sbjct: 220 NLVYPRCAMEALKQWSNVLGVEFSRNVSGVPS 251
>UBIE_RHIME (Q92SK7) Ubiquinone/menaquinone biosynthesis methyltransferase ubiE| (EC 2.1.1.-) Length = 258 Score = 27.3 bits (59), Expect = 9.6 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = +1 Query: 259 QLLEKGGELPHALLLDTGGSLLSV 330 +++E+ G HA +LD GS+LSV Sbjct: 87 RIVERSGRKAHATVLDINGSMLSV 110 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 48,497,798 Number of Sequences: 219361 Number of extensions: 870703 Number of successful extensions: 2124 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2094 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2124 length of database: 80,573,946 effective HSP length: 90 effective length of database: 60,831,456 effective search space used: 1459954944 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)