Clone Name | rbastl31g01 |
---|---|
Clone Library Name | barley_pub |
>MTAL1_KLULA (Q08398) Mating-type protein ALPHA1 (Transcription activator| Alpha1p) (MATalpha1 protein) Length = 261 Score = 30.4 bits (67), Expect = 1.8 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = +2 Query: 257 LQTIINTHVTSQKYTAQNWLLLTSQFLCGETPK 355 L TII+ H T K T +NW L+ ++ C + K Sbjct: 129 LSTIISKHWTVDKQTRKNWELIAQEYNCDASGK 161
>CCNB3_MOUSE (Q810T2) G2/mitotic-specific cyclin-B3| Length = 1396 Score = 29.3 bits (64), Expect = 3.9 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = -1 Query: 111 FLHNL*QCTVVLEYSVGYNISCQHCRSRKLN 19 ++ NL C LEY GY ++ H RKLN Sbjct: 1319 YMRNLSNCVPTLEYFTGYKMAELHILVRKLN 1349
>PCYOX_PONPY (Q5R748) Prenylcysteine oxidase precursor (EC 1.8.3.5)| Length = 505 Score = 28.9 bits (63), Expect = 5.2 Identities = 13/51 (25%), Positives = 26/51 (50%) Frame = -3 Query: 319 QQPVLSCIFLRGYMSVDYCLEERKKPWILVSRRRRPNSCWSLGMNKAFFFL 167 Q+ + L+ ++S DY + KKPW+ + P C S+ ++ ++L Sbjct: 410 QETLTKAQILKLFLSYDYAV---KKPWLAYPHYKPPEKCPSIILHDRLYYL 457
>PCYOX_MACFA (Q95KC9) Prenylcysteine oxidase precursor (EC 1.8.3.5)| Length = 505 Score = 28.9 bits (63), Expect = 5.2 Identities = 13/51 (25%), Positives = 26/51 (50%) Frame = -3 Query: 319 QQPVLSCIFLRGYMSVDYCLEERKKPWILVSRRRRPNSCWSLGMNKAFFFL 167 Q+ + L+ ++S DY + KKPW+ + P C S+ ++ ++L Sbjct: 410 QETLTKAQILKLFLSYDYAV---KKPWLAYPHYKPPEKCPSIILHDRLYYL 457
>PCYOX_HUMAN (Q9UHG3) Prenylcysteine oxidase precursor (EC 1.8.3.5) (PCL1)| Length = 505 Score = 28.9 bits (63), Expect = 5.2 Identities = 13/51 (25%), Positives = 26/51 (50%) Frame = -3 Query: 319 QQPVLSCIFLRGYMSVDYCLEERKKPWILVSRRRRPNSCWSLGMNKAFFFL 167 Q+ + L+ ++S DY + KKPW+ + P C S+ ++ ++L Sbjct: 410 QETLTKAQILKLFLSYDYAV---KKPWLAYPHYKPPEKCPSIILHDRLYYL 457
>AFAD_HUMAN (P55196) Afadin (AF-6 protein)| Length = 1816 Score = 28.9 bits (63), Expect = 5.2 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = +2 Query: 182 LVHPQAPARVRPPSPRDQNP 241 L+ P+AP RPP PRD P Sbjct: 1658 LLEPEAPGLCRPPLPRDYEP 1677
>TILS_BUCBP (Q89AX3) tRNA(Ile)-lysidine synthase (EC 6.3.4.-)| (tRNA(Ile)-lysidine synthetase) (tRNA(Ile)-2-lysyl-cytidine synthase) Length = 438 Score = 28.5 bits (62), Expect = 6.7 Identities = 14/36 (38%), Positives = 21/36 (58%) Frame = +2 Query: 5 RNNLRFSFRLLQC*HDIL*PTEYSKTTVHCYKLCKN 112 +NNL F+FR + H + +E K + HC K+C N Sbjct: 36 KNNLNFTFRAIHINHQLHPDSE--KWSDHCKKICIN 69
>YKG6_CAEEL (P46556) Hypothetical protein B0285.6 in chromosome III| Length = 577 Score = 28.5 bits (62), Expect = 6.7 Identities = 12/33 (36%), Positives = 19/33 (57%) Frame = -2 Query: 197 PGDEQGFFFSSSVKWDVFVSPPMLLFLFSSYTI 99 P ++ G + S W F PPM+ ++FSS+ I Sbjct: 246 PNEDHGISYLS---WMAFAIPPMIFYMFSSWFI 275 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 59,828,582 Number of Sequences: 219361 Number of extensions: 1170217 Number of successful extensions: 3107 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 3045 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3107 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2286875994 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)