Clone Name | rbastl31f12 |
---|---|
Clone Library Name | barley_pub |
>Y063_SYNY3 (Q55147) Hypothetical UPF0118 protein sll0063| Length = 395 Score = 30.4 bits (67), Expect = 1.3 Identities = 16/41 (39%), Positives = 22/41 (53%) Frame = -3 Query: 210 LSPSPLHHEETLVAQLRYWASILKRVIVELDVKVYILGWSI 88 L P L + LVA+L W ++ +V LD K ILGW + Sbjct: 107 LIPLALSQAQQLVARLPDWLDSGQKQLVLLDQKAEILGWPV 147
>IBP3_MOUSE (P47878) Insulin-like growth factor-binding protein 3 precursor| (IGFBP-3) (IBP-3) (IGF-binding protein 3) Length = 291 Score = 27.7 bits (60), Expect = 8.4 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = +3 Query: 39 NCTPTSFYPKEHCRPSK 89 NC FY K+ CRPSK Sbjct: 239 NCDKKGFYKKKRCRPSK 255
>IBP3_HUMAN (P17936) Insulin-like growth factor-binding protein 3 precursor| (IGFBP-3) (IBP-3) (IGF-binding protein 3) Length = 291 Score = 27.7 bits (60), Expect = 8.4 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = +3 Query: 39 NCTPTSFYPKEHCRPSK 89 NC FY K+ CRPSK Sbjct: 239 NCDKKGFYKKKQCRPSK 255
>IBP3_BOVIN (P20959) Insulin-like growth factor-binding protein 3 precursor| (IGFBP-3) (IBP-3) (IGF-binding protein 3) Length = 291 Score = 27.7 bits (60), Expect = 8.4 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = +3 Query: 39 NCTPTSFYPKEHCRPSK 89 NC FY K+ CRPSK Sbjct: 239 NCDKKGFYKKKQCRPSK 255
>IBP3_RAT (P15473) Insulin-like growth factor-binding protein 3 precursor| (IGFBP-3) (IBP-3) (IGF-binding protein 3) Length = 292 Score = 27.7 bits (60), Expect = 8.4 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = +3 Query: 39 NCTPTSFYPKEHCRPSK 89 NC FY K+ CRPSK Sbjct: 240 NCDKKGFYKKKQCRPSK 256
>IBP3_PIG (P16611) Insulin-like growth factor-binding protein 3 precursor| (IGFBP-3) (IBP-3) (IGF-binding protein 3) Length = 293 Score = 27.7 bits (60), Expect = 8.4 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = +3 Query: 39 NCTPTSFYPKEHCRPSK 89 NC FY K+ CRPSK Sbjct: 241 NCDKKGFYKKKQCRPSK 257 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 32,837,458 Number of Sequences: 219361 Number of extensions: 572770 Number of successful extensions: 1364 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1351 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1364 length of database: 80,573,946 effective HSP length: 49 effective length of database: 69,825,257 effective search space used: 1675806168 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)