Clone Name | rbastl31f10 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | BBS10_PONPY (Q5R8P3) Bardet-Biedl syndrome 10 protein homolog | 28 | 6.3 |
---|
>BBS10_PONPY (Q5R8P3) Bardet-Biedl syndrome 10 protein homolog| Length = 723 Score = 28.1 bits (61), Expect = 6.3 Identities = 15/52 (28%), Positives = 26/52 (50%), Gaps = 1/52 (1%) Frame = +1 Query: 58 VNLGKTTRRKGLCRFRCISRVTAH-TRNLGENNNKIASCAKLDYYYYCSTLE 210 +++ + + K LCR + A+ +G NN+K S DY++ C T E Sbjct: 154 LSIFSSAKEKTLCRSSLELLLEAYFCGRVGRNNHKFISQLMCDYFFKCMTCE 205 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 29,666,400 Number of Sequences: 219361 Number of extensions: 447846 Number of successful extensions: 1028 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1022 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1028 length of database: 80,573,946 effective HSP length: 56 effective length of database: 68,289,730 effective search space used: 1638953520 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)