Clone Name | rbastl31f07 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | C71E1_SORBI (O48958) Cytochrome P450 71E1 (EC 1.14.13.68) (4-hyd... | 33 | 0.15 | 2 | ERG1_SCHPO (Q9C1W3) Probable squalene monooxygenase (EC 1.14.99.... | 29 | 3.6 | 3 | GA2L1_HUMAN (Q99501) GAS2-like protein 1 (Growth arrest-specific... | 28 | 8.0 | 4 | COHA1_MESAU (Q9JMH4) Collagen alpha-1(XVII) chain (Bullous pemph... | 28 | 8.0 |
---|
>C71E1_SORBI (O48958) Cytochrome P450 71E1 (EC 1.14.13.68)| (4-hydroxyphenylacetaldehyde oxime monooxygenase) Length = 531 Score = 33.5 bits (75), Expect = 0.15 Identities = 14/24 (58%), Positives = 18/24 (75%) Frame = -1 Query: 274 VGVEEFGGLPFRKKKPLVLVPTRY 203 V +EE G L F +K PLV+VPT+Y Sbjct: 502 VSMEETGALTFHRKTPLVVVPTKY 525
>ERG1_SCHPO (Q9C1W3) Probable squalene monooxygenase (EC 1.14.99.7) (Squalene| epoxidase) (SE) Length = 457 Score = 28.9 bits (63), Expect = 3.6 Identities = 14/46 (30%), Positives = 22/46 (47%) Frame = -3 Query: 242 PEKKATRAGANTLLPRQGGEVVFSICFSLNKNKRAAYLLSPSTLIC 105 P T A N LL + GEV+ + S K++ +P T++C Sbjct: 121 PNVTVTEATVNELLRDETGEVITGVVTSSKKSESPVEYKAPLTIVC 166
>GA2L1_HUMAN (Q99501) GAS2-like protein 1 (Growth arrest-specific 2-like 1)| (GAS2-related protein on chromosome 22) (GAR22 protein) Length = 681 Score = 27.7 bits (60), Expect = 8.0 Identities = 20/52 (38%), Positives = 25/52 (48%), Gaps = 8/52 (15%) Frame = +1 Query: 142 RLFLFKEKHIENTTSP----PCLGS----SVLAPARVAFFSGKGGPQTPPRP 273 R+ F + + TTSP P GS S V+ S K GP+TPPRP Sbjct: 287 RVCTFSPQRVSPTTSPRPASPVPGSERRGSRPEMTPVSLRSTKEGPETPPRP 338
>COHA1_MESAU (Q9JMH4) Collagen alpha-1(XVII) chain (Bullous pemphigoid antigen 2)| (180 kDa bullous pemphigoid antigen 2) Length = 1431 Score = 27.7 bits (60), Expect = 8.0 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +1 Query: 172 ENTTSPPCLGSSVLAPARVAFFSGKGGPQTPPRP 273 E PP L S L + FFSG GP PP P Sbjct: 914 EGVPGPPGLPGSFLTDSET-FFSGPPGPPGPPGP 946 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 39,488,084 Number of Sequences: 219361 Number of extensions: 685865 Number of successful extensions: 1702 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1662 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1702 length of database: 80,573,946 effective HSP length: 66 effective length of database: 66,096,120 effective search space used: 1586306880 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)