Clone Name | rbastl31f04 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | APC1_YEAST (P53886) Anaphase-promoting complex subunit 1 | 29 | 6.8 |
---|
>APC1_YEAST (P53886) Anaphase-promoting complex subunit 1| Length = 1748 Score = 28.9 bits (63), Expect = 6.8 Identities = 14/45 (31%), Positives = 19/45 (42%) Frame = +3 Query: 321 MVEFAAMGSCWRQTIILNQHSIRTAPLCVDMNLGFLITCSSTGWY 455 MVE + S T + + S LC D N G ++ C WY Sbjct: 1696 MVELDTLLSAGNNTALTDSESYNLGLLCSDKNSGDILDCQLELWY 1740 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 65,330,070 Number of Sequences: 219361 Number of extensions: 1208160 Number of successful extensions: 2412 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 2356 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2412 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 3026354448 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)