Clone Name | rbastl31e12 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | FGR_HUMAN (P09769) Proto-oncogene tyrosine-protein kinase FGR (E... | 28 | 7.4 | 2 | I11RA_RAT (Q99MF4) Interleukin-11 receptor alpha chain precursor... | 28 | 7.4 |
---|
>FGR_HUMAN (P09769) Proto-oncogene tyrosine-protein kinase FGR (EC 2.7.10.2)| (P55-FGR) (C-FGR) Length = 529 Score = 27.7 bits (60), Expect = 7.4 Identities = 12/20 (60%), Positives = 15/20 (75%) Frame = -1 Query: 294 RLGRADAERGLLADHEPQGA 235 ++GR DAER LL+ PQGA Sbjct: 148 KIGRKDAERQLLSPGNPQGA 167
>I11RA_RAT (Q99MF4) Interleukin-11 receptor alpha chain precursor| (IL-11R-alpha) (IL-11RA) Length = 431 Score = 27.7 bits (60), Expect = 7.4 Identities = 17/46 (36%), Positives = 22/46 (47%), Gaps = 2/46 (4%) Frame = +3 Query: 201 RPTSRPGSFTSPPLGVHDLREDRARRQP--VRVDARDALVAHAYGS 332 RP P T P+G+ +L D P VRV ARD L A + + Sbjct: 261 RPAQHPAWSTVEPIGLEELITDAVAGLPHAVRVSARDFLDAGTWSA 306 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 42,676,062 Number of Sequences: 219361 Number of extensions: 718696 Number of successful extensions: 1451 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1434 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1451 length of database: 80,573,946 effective HSP length: 86 effective length of database: 61,708,900 effective search space used: 1481013600 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)