| Clone Name | rbastl31e01 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PPZ_SCHPO (P78968) Serine/threonine-protein phosphatase PP-Z (EC... | 30 | 1.1 | 2 | L_EBOSM (Q66802) Large structural protein (L protein) (Transcrip... | 28 | 6.9 | 3 | DPOA2_YEAST (P38121) DNA polymerase alpha subunit B (P86 subunit) | 27 | 9.0 | 4 | POL_HV2RO (P04584) Gag-Pol polyprotein (Pr160Gag-Pol) [Contains:... | 27 | 9.0 |
|---|
>PPZ_SCHPO (P78968) Serine/threonine-protein phosphatase PP-Z (EC 3.1.3.16)| Length = 515 Score = 30.4 bits (67), Expect = 1.1 Identities = 16/48 (33%), Positives = 25/48 (52%) Frame = +1 Query: 205 NQGMATTFPL*QPSTRKPGSGALMHHHNQT*HASSHGVKPSYSASLTS 348 +Q + P QP+ P + A HHH+ + +SS+ V P+ S TS Sbjct: 96 SQSPTSPHPSNQPAMLSPSTAASQHHHHHS-SSSSYAVSPTSPTSPTS 142
>L_EBOSM (Q66802) Large structural protein (L protein) (Transcriptase)| (Replicase) [Includes: RNA-directed RNA polymerase (EC 2.7.7.48); mRNA (guanine-N(7)-)-methyltransferase (EC 2.1.1.56); mRNA guanylyltransferase (EC 2.7.7.-)] Length = 2210 Score = 27.7 bits (60), Expect = 6.9 Identities = 15/48 (31%), Positives = 26/48 (54%) Frame = +3 Query: 45 SAFMFPVPFDSRVPTSHQKQTDSTLHGSSS*QSGTMYAVWFSWQRNRI 188 S + P S +P +H+ + + L+ S+S + + WFS Q+NRI Sbjct: 1867 SGYTTPRMLLSVMPRTHRGELEVILNNSASQITDITHRDWFSNQKNRI 1914
>DPOA2_YEAST (P38121) DNA polymerase alpha subunit B (P86 subunit)| Length = 705 Score = 27.3 bits (59), Expect = 9.0 Identities = 16/42 (38%), Positives = 21/42 (50%) Frame = +3 Query: 24 SQNKLEFSAFMFPVPFDSRVPTSHQKQTDSTLHGSSS*QSGT 149 S KLEF+ M P SH K +D+ GSS+ Q+ T Sbjct: 146 SSLKLEFTPGMAEDAVGDSAPLSHAKSSDAKTPGSSTFQTPT 187
>POL_HV2RO (P04584) Gag-Pol polyprotein (Pr160Gag-Pol) [Contains: Matrix| protein p17 (MA); Capsid protein p24 (CA); p2 spacer peptide; Nucleocapsid protein* (NC*); Transframe peptide (TF) (p6 pol); Protease (EC 3.4.23.47) (Retropepsin) (PR); Reverse trans Length = 1463 Score = 27.3 bits (59), Expect = 9.0 Identities = 17/45 (37%), Positives = 23/45 (51%) Frame = +3 Query: 78 RVPTSHQKQTDSTLHGSSS*QSGTMYAVWFSWQRNRIELLQEEPR 212 R P+S T+ST GSSS +G +YA +R E +Q R Sbjct: 446 RGPSSAGADTNSTPSGSSSGSTGEIYAAREKTERAERETIQGSDR 490 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 54,035,816 Number of Sequences: 219361 Number of extensions: 1016347 Number of successful extensions: 2233 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2201 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2233 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 1375720320 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)