Clone Name | rbastl31d06 |
---|---|
Clone Library Name | barley_pub |
>CUT1_SCHPO (P18296) Separin (EC 3.4.22.49) (Separase) (Cell untimely torn| protein 1) Length = 1828 Score = 31.2 bits (69), Expect = 0.61 Identities = 17/46 (36%), Positives = 22/46 (47%), Gaps = 3/46 (6%) Frame = -1 Query: 247 TDKDDETVD*KMAADRWLMQNHATLPTLVSLCV---QNRPCCKLRY 119 TDKD + KM L +N A S+C ++R CC LRY Sbjct: 1766 TDKDIDRFSLKMLESWGLFENKAPFVNSTSICTAVSESRSCCHLRY 1811
>INVA_PHAVU (O24509) Acid beta-fructofuranosidase precursor (EC 3.2.1.26) (Acid| sucrose hydrolase) (Acid invertase) (AI) (Vacuolar invertase) Length = 651 Score = 28.9 bits (63), Expect = 3.0 Identities = 18/51 (35%), Positives = 24/51 (47%) Frame = +1 Query: 148 GHTRKQELVMWHGSASASGQQPFSNQQSRRPCQLPADRWTKGSSPVQSGSS 300 G R + H S+SAS Q Q+ + P LP+ +W S V SG S Sbjct: 41 GRNRASNVPHDHVSSSASNHQ----QEHQSPTSLPSSKWHAVSRGVSSGVS 87
>UBP5_HUMAN (P45974) Ubiquitin carboxyl-terminal hydrolase 5 (EC 3.1.2.15)| (Ubiquitin thioesterase 5) (Ubiquitin-specific-processing protease 5) (Deubiquitinating enzyme 5) (Isopeptidase T) Length = 858 Score = 28.5 bits (62), Expect = 4.0 Identities = 12/37 (32%), Positives = 18/37 (48%) Frame = +1 Query: 154 TRKQELVMWHGSASASGQQPFSNQQSRRPCQLPADRW 264 +RKQE+ W G + FS +Q P ++P W Sbjct: 161 SRKQEVQAWDGEVRQVSKHAFSLKQLDNPARIPPCGW 197
>HDC_DROME (Q9N2M8) Headcase protein [Contains: Headcase short protein]| Length = 1080 Score = 28.1 bits (61), Expect = 5.2 Identities = 22/71 (30%), Positives = 30/71 (42%) Frame = +1 Query: 133 NKACSGHTRKQELVMWHGSASASGQQPFSNQQSRRPCQLPADRWTKGSSPVQSGSSLRWG 312 N + S + L++ H SAS +G + +P T G S S WG Sbjct: 844 NSSSSSSSSISNLIISHNSASNTGNK-------MQP--------TWGQS---DAISALWG 885 Query: 313 CSSEMSGCNLG 345 CSS SGC+ G Sbjct: 886 CSSSSSGCSSG 896
>LRC25_BOVIN (Q8MII8) Leucine-rich repeat-containing protein 25 precursor| (Monocyte and plasmacytoid-activated protein) Length = 307 Score = 28.1 bits (61), Expect = 5.2 Identities = 15/33 (45%), Positives = 21/33 (63%) Frame = +1 Query: 184 GSASASGQQPFSNQQSRRPCQLPADRWTKGSSP 282 GS S SG+QP + Q RRP + PA+ + S+P Sbjct: 211 GSRSGSGRQPRYSSQGRRP-KSPANTPPRSSTP 242
>GON4L_MOUSE (Q9DB00) GON-4-like protein (GON-4 homolog)| Length = 2260 Score = 27.7 bits (60), Expect = 6.8 Identities = 17/58 (29%), Positives = 22/58 (37%) Frame = +1 Query: 142 CSGHTRKQELVMWHGSASASGQQPFSNQQSRRPCQLPADRWTKGSSPVQSGSSLRWGC 315 C+ K+E WH SA Q+ FS A W + Q GSS + C Sbjct: 1264 CTTVFSKEEPKSWHSSADTGSQEAFSESS--------ACSWAVVKTESQEGSSEKSAC 1313
>CRIM1_CHICK (Q8AWW5) Cysteine-rich motor neuron 1 protein precursor (CRIM-1)| Length = 1048 Score = 27.7 bits (60), Expect = 6.8 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -3 Query: 209 C*PLADAEPCHITNSCFLVCPE 144 C PL AEP ++ SC +CPE Sbjct: 866 CPPLPCAEPINVEGSCCPMCPE 887
>TGBR3_RAT (P26342) TGF-beta receptor type III precursor (TGFR-3)| (Transforming growth factor beta receptor III) (Betaglycan) Length = 853 Score = 27.7 bits (60), Expect = 6.8 Identities = 15/30 (50%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Frame = +2 Query: 200 AVSSHFLINSLVVLVS-CLRTGGRRGVARC 286 AV+SH +I +VVL+S CL T G RC Sbjct: 2 AVTSHHMIPVMVVLMSACLATAGPEPSTRC 31
>ASPA_PROMP (P59830) Probable aspartoacylase (EC 3.5.1.15)| Length = 295 Score = 27.3 bits (59), Expect = 8.9 Identities = 12/35 (34%), Positives = 23/35 (65%), Gaps = 4/35 (11%) Frame = +2 Query: 164 KSW*CGMVLHQPAVSSHF----LINSLVVLVSCLR 256 ++W CG+VL +V+ +F +IN ++++S LR Sbjct: 149 EAWPCGLVLEIGSVAQNFYDPKIINRFLIIISSLR 183
>UBP5_MOUSE (P56399) Ubiquitin carboxyl-terminal hydrolase 5 (EC 3.1.2.15)| (Ubiquitin thioesterase 5) (Ubiquitin-specific-processing protease 5) (Deubiquitinating enzyme 5) (Isopeptidase T) Length = 858 Score = 27.3 bits (59), Expect = 8.9 Identities = 11/37 (29%), Positives = 18/37 (48%) Frame = +1 Query: 154 TRKQELVMWHGSASASGQQPFSNQQSRRPCQLPADRW 264 +RKQE+ W G + F+ +Q P ++P W Sbjct: 161 SRKQEVQAWDGEVRQVSKHAFNLKQLDNPARIPPCGW 197 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 49,073,860 Number of Sequences: 219361 Number of extensions: 831316 Number of successful extensions: 1918 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 1879 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1917 length of database: 80,573,946 effective HSP length: 111 effective length of database: 56,224,875 effective search space used: 1349397000 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)