>MRPD_BACSU (O05229) Na(+)/H(+) antiporter subunit D (Multiple resistance and|
           pH homeostasis protein D) (Mrp complex subunit D)
          Length = 493

 Score = 29.6 bits (65), Expect = 3.5
 Identities = 12/44 (27%), Positives = 24/44 (54%)
 Frame = +3

Query: 189 NILFFLNAELCASNTILLTRHSFWENEEENPQTTFQHGKASVYP 320
           ++L  L++ L   + + +  H+FW  E+E P+   +  K  +YP
Sbjct: 408 SMLILLSSLLVLYSVLRIFIHAFWGEEKETPKPNHRTAKGLLYP 451


  Database: uniprot_sprot.fasta
    Posted date:  May 25, 2006  5:36 PM
  Number of letters in database: 80,573,946
  Number of sequences in database:  219,361
  
Lambda     K      H
   0.318    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 63,505,939
Number of Sequences: 219361
Number of extensions: 1249218
Number of successful extensions: 3207
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 2892
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3196
length of database: 80,573,946
effective HSP length: 101
effective length of database: 58,418,485
effective search space used: 2628831825
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)