Clone Name | rbastl31d02 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | LX12L_MOUSE (P39654) Arachidonate 12-lipoxygenase, leukocyte-typ... | 29 | 5.9 | 2 | LOX12_BOVIN (P27479) Arachidonate 12-lipoxygenase, 12S-type (EC ... | 29 | 7.7 |
---|
>LX12L_MOUSE (P39654) Arachidonate 12-lipoxygenase, leukocyte-type (EC| 1.13.11.31) (12-LOX) Length = 662 Score = 29.3 bits (64), Expect = 5.9 Identities = 16/37 (43%), Positives = 22/37 (59%) Frame = -2 Query: 439 RAEKMPVSEDGYLDLSRQVVSVKSGGRLEILMQAGDF 329 RA +SE G+ D +V+S GG L++L QAG F Sbjct: 402 RARSDLISERGFFD---KVMSTGGGGHLDLLKQAGAF 435
>LOX12_BOVIN (P27479) Arachidonate 12-lipoxygenase, 12S-type (EC 1.13.11.31)| (12-LOX) Length = 662 Score = 28.9 bits (63), Expect = 7.7 Identities = 17/37 (45%), Positives = 21/37 (56%) Frame = -2 Query: 439 RAEKMPVSEDGYLDLSRQVVSVKSGGRLEILMQAGDF 329 RA VS+ G D QVVS GG +E+L +AG F Sbjct: 402 RARTGLVSDSGVFD---QVVSTGGGGHVELLQRAGAF 435 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 63,520,590 Number of Sequences: 219361 Number of extensions: 1215685 Number of successful extensions: 2793 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2761 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2793 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3420806017 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)