Clone Name | rbastl31c11 |
---|---|
Clone Library Name | barley_pub |
>NR4A1_CANFA (P51666) Orphan nuclear receptor NR4A1 (Orphan nuclear receptor| HMR) (Orphan nuclear receptor NGFI-B) Length = 598 Score = 28.5 bits (62), Expect = 4.1 Identities = 15/30 (50%), Positives = 19/30 (63%) Frame = +2 Query: 137 DRLLGQLPGAAHDLKSLNSAASSTSWNVST 226 D L QLPG A S +S+ASSTS + +T Sbjct: 65 DTFLYQLPGTAQPCSSASSSASSTSSSSAT 94
>LITH_BOVIN (P23132) Lithostathine precursor (Pancreatic stone protein) (PSP)| (Pancreatic thread protein) (PTP) (Islet of Langerhans regenerating protein) (REG) (Islet cells regeneration factor) (ICRF) [Contains: Lithostathine A chain; Lithostathine B cha Length = 175 Score = 28.5 bits (62), Expect = 4.1 Identities = 20/52 (38%), Positives = 26/52 (50%), Gaps = 1/52 (1%) Frame = +2 Query: 143 LLGQLPGAAHDLKSLNSAASSTSWNVSTYRSGCLALWK-PQEPIDRRVGCSK 295 LL Q+ G + K L SA S YRS C AL+K P+ +D + C K Sbjct: 20 LLSQIQGE-NSQKELPSARISCPSGSMAYRSHCYALFKTPKTWMDADIACQK 70
>DUT_VZVD (P09254) Deoxyuridine 5'-triphosphate nucleotidohydrolase (EC| 3.6.1.23) (dUTPase) (dUTP pyrophosphatase) Length = 396 Score = 27.7 bits (60), Expect = 7.0 Identities = 16/46 (34%), Positives = 23/46 (50%), Gaps = 1/46 (2%) Frame = +1 Query: 34 LMIIRKHNVQHSQTWKKFNNYFYNRIQHAKA-ILH*PTTWPAARSC 168 L IIR ++QH N Y + R +++ I+ PT WPA C Sbjct: 260 LPIIRDWDLQHPS----INAYIFGRSSKSRSGIIVCPTAWPAGEHC 301
>MANA_ECHMU (Q9GP38) Probable mannose-6-phosphate isomerase (EC 5.3.1.8)| (Phosphomannose isomerase) (PMI) (Phosphohexomutase) Length = 433 Score = 27.7 bits (60), Expect = 7.0 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = -2 Query: 246 ARQPDLYVDTFHEVDEAAELSDFRS 172 A QPDLY D H+ + A L+DF + Sbjct: 116 AEQPDLYKDGSHKPEMAIALTDFEA 140
>AROC_THET8 (Q5SII5) Chorismate synthase (EC 4.2.3.5)| (5-enolpyruvylshikimate-3-phosphate phospholyase) Length = 383 Score = 27.3 bits (59), Expect = 9.1 Identities = 11/27 (40%), Positives = 18/27 (66%), Gaps = 5/27 (18%) Frame = -2 Query: 198 AAELSDFRSWA-----APGSWPSSRSM 133 A + +DF++WA APG+WP R++ Sbjct: 75 AIKNADFKNWAEIMDPAPGNWPRKRAL 101
>AROC_THET2 (Q72IW3) Chorismate synthase (EC 4.2.3.5)| (5-enolpyruvylshikimate-3-phosphate phospholyase) Length = 383 Score = 27.3 bits (59), Expect = 9.1 Identities = 11/27 (40%), Positives = 18/27 (66%), Gaps = 5/27 (18%) Frame = -2 Query: 198 AAELSDFRSWA-----APGSWPSSRSM 133 A + +DF++WA APG+WP R++ Sbjct: 75 AIKNADFKNWAEIMDPAPGNWPRKRAL 101
>Y1609_METJA (Q59004) Hypothetical ATP-binding protein MJ1609| Length = 374 Score = 27.3 bits (59), Expect = 9.1 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = -2 Query: 234 DLYVDTFHEVDEAAELSDFRSWA 166 D +++ EVDE +E+ DFR +A Sbjct: 68 DNFIECLFEVDEKSEIDDFREYA 90
>SULH_SCHPO (O74377) Probable sulfate permease C3H7.02| Length = 877 Score = 27.3 bits (59), Expect = 9.1 Identities = 15/35 (42%), Positives = 17/35 (48%) Frame = -2 Query: 258 GFHKARQPDLYVDTFHEVDEAAELSDFRSWAAPGS 154 GF KAR Y EV AA L D + APG+ Sbjct: 726 GFGKARDATKYTSRSIEVGSAAPLRDIETPMAPGN 760
>MMT1_WOLBI (Q9SWR3) Methionine S-methyltransferase (EC 2.1.1.12) (AdoMet:Met| S-methyltransferase) Length = 1088 Score = 27.3 bits (59), Expect = 9.1 Identities = 18/73 (24%), Positives = 26/73 (35%), Gaps = 8/73 (10%) Frame = +2 Query: 101 TIEYNTQKQFCIDRLLGQLPGAAHD--------LKSLNSAASSTSWNVSTYRSGCLALWK 256 T+ Y +K + G L GAA LK L + W V R G + K Sbjct: 952 TVRYTAKKLLELGEQKGNLTGAAQGQEKLLATRLKRLKETLENCGWEVIEARGGVSVIAK 1011 Query: 257 PQEPIDRRVGCSK 295 P + + + K Sbjct: 1012 PSAYLGKNIKLEK 1024
>NU6M_XENLA (P03927) NADH-ubiquinone oxidoreductase chain 6 (EC 1.6.5.3) (NADH| dehydrogenase subunit 6) Length = 170 Score = 27.3 bits (59), Expect = 9.1 Identities = 15/49 (30%), Positives = 25/49 (51%), Gaps = 2/49 (4%) Frame = -2 Query: 210 EVDEAAELSDFRSWAAPGSWPSSRSMQNCFCVL--YSIVKIVVEFLPGL 70 EVD + S+ S+ G W M +C+ V+ Y V I++ F+ G+ Sbjct: 108 EVDGMNKSSELGSYVMRGDWVGVALMYSCWWVIIVYWWVSIIINFVCGI 156
>POLG_JAEV5 (P19110) Genome polyprotein [Contains: Capsid protein C (Core| protein); Envelope protein M (Matrix protein); Major envelope protein E; Nonstructural protein 1 (NS1); Nonstructural protein 2A (NS2A); Flavivirin protease NS2B regulatory subunit; Length = 3432 Score = 27.3 bits (59), Expect = 9.1 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = +2 Query: 161 GAAHDLKSLNSAASSTSWNVSTYRSGCLALWKPQEPID 274 GA H+ L S WN+ + +SG +KP EP D Sbjct: 2634 GAGHEEPML---MQSYGWNLVSLKSGVDVFYKPSEPSD 2668
>POLG_JAEV1 (P27395) Genome polyprotein [Contains: Capsid protein C (Core| protein); Envelope protein M (Matrix protein); Major envelope protein E; Nonstructural protein 1 (NS1); Nonstructural protein 2A (NS2A); Flavivirin protease NS2B regulatory subunit; Length = 3432 Score = 27.3 bits (59), Expect = 9.1 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = +2 Query: 161 GAAHDLKSLNSAASSTSWNVSTYRSGCLALWKPQEPID 274 GA H+ L S WN+ + +SG +KP EP D Sbjct: 2634 GAGHEEPML---MQSYGWNLVSLKSGVDVFYKPSEPSD 2668 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 56,623,972 Number of Sequences: 219361 Number of extensions: 1074977 Number of successful extensions: 2670 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 2616 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2670 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 1391514312 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)