| Clone Name | rbastl31b08 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | RAS2_NEUCR (Q01387) Protein ras-2 | 28 | 5.5 | 2 | SPR6_YEAST (Q01684) Sporulation-specific protein (SPR6) | 28 | 5.5 |
|---|
>RAS2_NEUCR (Q01387) Protein ras-2| Length = 229 Score = 28.1 bits (61), Expect = 5.5 Identities = 14/34 (41%), Positives = 22/34 (64%) Frame = +3 Query: 102 LQLCRM*LKHFEGKYVCT*EDN*RKQIYVEKKSC 203 +QLC L+HF Y T ED+ RKQ+ ++ ++C Sbjct: 26 IQLC---LEHFVETYDPTIEDSYRKQVVIDGQAC 56
>SPR6_YEAST (Q01684) Sporulation-specific protein (SPR6)| Length = 191 Score = 28.1 bits (61), Expect = 5.5 Identities = 15/55 (27%), Positives = 22/55 (40%) Frame = -1 Query: 243 GISDEPGLRCLTLNRIFFPHRFAFFSCLLRYTHICLQSVLITFCKVAAHYRMVFF 79 G+ +PG RC FP A FSC C S + +A + ++F Sbjct: 137 GVHPKPGERCACQQATLFPSPLARFSCDQSAVLGCAASSTRVYDSIADEFSSLYF 191 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 52,963,526 Number of Sequences: 219361 Number of extensions: 965790 Number of successful extensions: 1724 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1694 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1722 length of database: 80,573,946 effective HSP length: 98 effective length of database: 59,076,568 effective search space used: 1417837632 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)