Clone Name | rbastl31b02 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | Y550_BUCAI (P57615) Oxygen-independent coproporphyrinogen III ox... | 30 | 2.5 | 2 | ADAM8_MOUSE (Q05910) ADAM 8 precursor (EC 3.4.24.-) (A disintegr... | 30 | 4.3 | 3 | LAP2A_HUMAN (P42166) Lamina-associated polypeptide 2 isoform alp... | 29 | 5.6 | 4 | CPS1_PENJA (P34946) Carboxypeptidase S1 (EC 3.4.16.6) | 29 | 7.3 |
---|
>Y550_BUCAI (P57615) Oxygen-independent coproporphyrinogen III oxidase-like| protein BU550 (EC 1.3.99.-) Length = 376 Score = 30.4 bits (67), Expect = 2.5 Identities = 13/40 (32%), Positives = 23/40 (57%) Frame = +2 Query: 317 PTVAKHLRRRWYLKQCQSICIRSRSSNQVITLNRHLEHLL 436 P ++ ++ W LK+C S S ++I N+++EHLL Sbjct: 5 PPISLYIHIPWCLKKCGYCDFYSYVSKEIIPENKYIEHLL 44
>ADAM8_MOUSE (Q05910) ADAM 8 precursor (EC 3.4.24.-) (A disintegrin and| metalloproteinase domain 8) (Cell surface antigen MS2) (Macrophage cysteine-rich glycoprotein) (CD156 antigen) Length = 826 Score = 29.6 bits (65), Expect = 4.3 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = +2 Query: 260 FQQNSEPFHPSNFCMTGAHPTVAKHLRRRW 349 FQQN P P +C G+ PT+A+ R W Sbjct: 486 FQQNGTPC-PGGYCFDGSCPTLAQQCRDLW 514
>LAP2A_HUMAN (P42166) Lamina-associated polypeptide 2 isoform alpha| (Thymopoietin isoform alpha) (TP alpha) (Thymopoietin-related peptide isoform alpha) (TPRP isoform alpha) [Contains: Thymopoietin (TP) (Splenin); Thymopentin (TP5)] Length = 693 Score = 29.3 bits (64), Expect = 5.6 Identities = 18/69 (26%), Positives = 30/69 (43%) Frame = +2 Query: 212 CKRQTSHPISRSGSHNFQQNSEPFHPSNFCMTGAHPTVAKHLRRRWYLKQCQSICIRSRS 391 CK + +S S +S+P H + T A P++ K +Y ++IC R +S Sbjct: 279 CKSSHDRCLEKSSS----SSSQPEHSAMLVSTAASPSLIKETTTGYYKDIVENICGREKS 334 Query: 392 SNQVITLNR 418 Q + R Sbjct: 335 GIQPLCPER 343
>CPS1_PENJA (P34946) Carboxypeptidase S1 (EC 3.4.16.6)| Length = 423 Score = 28.9 bits (63), Expect = 7.3 Identities = 15/57 (26%), Positives = 28/57 (49%), Gaps = 4/57 (7%) Frame = +2 Query: 206 SLCKRQTSHPISRSGSHNF----QQNSEPFHPSNFCMTGAHPTVAKHLRRRWYLKQC 364 S+C + PIS SG + + +++P+ P + + PTV K + R ++C Sbjct: 244 SVCYQNIEGPISSSGDFDVYDIREPSNDPYPPKTYSTYLSDPTVVKAIGARTNYQEC 300 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 64,172,001 Number of Sequences: 219361 Number of extensions: 1178125 Number of successful extensions: 2426 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2379 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2426 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3246866728 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)