Clone Name | rbastl31a04 |
---|---|
Clone Library Name | barley_pub |
>U202B_ARATH (Q9M2Q4) Hypothetical UPF0202 protein At3g57940| Length = 1024 Score = 33.1 bits (74), Expect = 0.40 Identities = 18/38 (47%), Positives = 27/38 (71%), Gaps = 7/38 (18%) Frame = -2 Query: 404 KALQNEKLSASGVISVKSSKT-------SADKKRSTGK 312 +ALQ+ K+S+SG+ISVKS+K+ + KKRS+ K Sbjct: 968 EALQHSKISSSGIISVKSTKSENENGFDKSTKKRSSDK 1005
>MEC10_CAEEL (P34886) Degenerin mec-10 (Mechanosensory abnormality protein 10)| Length = 724 Score = 29.6 bits (65), Expect = 4.4 Identities = 18/73 (24%), Positives = 36/73 (49%), Gaps = 3/73 (4%) Frame = -1 Query: 267 EKKKNRT*SCHLELRWSDPGILKSPEKPLQGLSSRRGKREAEVAKQAIICRISLTNLSKT 88 +++ N CH + +W++ E L +++G + +E+ K+ IC SK Sbjct: 276 DRQTNDAWPCHRKEQWTNTTCQTCDEHYLCSKKAKKGTKRSELKKEPCICE------SKG 329 Query: 87 LW---HHHASILL 58 L+ H HA+++L Sbjct: 330 LFCIKHEHAAMVL 342
>YCE1_YEAST (P25571) Hypothetical 19.1 kDa protein in PDI1-GLK1 intergenic| region Length = 164 Score = 28.9 bits (63), Expect = 7.5 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = +3 Query: 267 PIYHHYLVLSFSIFCFPCASLLVSTCFAG 353 P H Y+ + IFC+ C LL + C G Sbjct: 90 PYGHTYIYIYIYIFCYACIFLLQAACLIG 118
>STP3_SHEEP (O97965) Spermatid nuclear transition protein 3 (STP-3) (TP-3)| (TP3) (Spermatidal protein 3) Length = 109 Score = 28.5 bits (62), Expect = 9.7 Identities = 20/73 (27%), Positives = 36/73 (49%), Gaps = 7/73 (9%) Frame = -3 Query: 481 ESRMKQLWTQSYCRSARLKEMTLRLRKLCRMRNCLQAAL-SV*NPAKQVLTRREAQ---- 317 + R K LW + Y S + MT+R+R+ ++ L+ + S P+K+V RE Sbjct: 22 KGRKKTLWQRRYRGSVKAPNMTMRVRR--PLKGTLRKKIRSYATPSKKVKNTREPNCFLR 79 Query: 316 --GKQKIEKERTR 284 ++K+ + R R Sbjct: 80 SCAREKLNQSRKR 92
>PRIA_BUCAP (Q8KA15) Primosomal protein N' (EC 3.6.1.-) (ATP-dependent helicase| priA) (Replication factor Y) Length = 720 Score = 28.5 bits (62), Expect = 9.7 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = +1 Query: 379 DNFSFCRAFSISRSSPLIAHFCNNF 453 DNF FCR I PL + C NF Sbjct: 447 DNFLFCRNCLIKIKKPLFCYNCKNF 471 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 63,341,340 Number of Sequences: 219361 Number of extensions: 1127079 Number of successful extensions: 4174 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 4114 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4173 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3304846491 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)