| Clone Name | rbastl31a03 |
|---|---|
| Clone Library Name | barley_pub |
>WRN_CAEEL (Q19546) Probable Werner syndrome ATP-dependent helicase homolog 1| (EC 3.6.1.-) Length = 1056 Score = 31.2 bits (69), Expect = 1.2 Identities = 25/84 (29%), Positives = 40/84 (47%), Gaps = 9/84 (10%) Frame = +2 Query: 65 CIITRTYHTGYRLTNPSTIDITPPELITSMQ---------VYTRMESTRTHIREEKMRTN 217 C++ + TG TN + D+ PPELI+ MQ VYT +R+ +E Sbjct: 875 CVVQFSKETGIA-TNVNANDMIPPELISKMQKVLSDAVRRVYTEHLISRSTAKEVATARG 933 Query: 218 RSSKTRWSFIEACSSCSGEEGTPL 289 S T +S++ + + E+G PL Sbjct: 934 ISEGTVYSYL----AMAVEKGLPL 953
>FANCJ_CHICK (Q3YK19) Fanconi anemia group J protein homolog (EC 3.6.1.-)| (ATP-dependent RNA helicase BRIP1) (Protein FACJ) Length = 1252 Score = 30.4 bits (67), Expect = 2.0 Identities = 14/47 (29%), Positives = 26/47 (55%) Frame = +2 Query: 137 ELITSMQVYTRMESTRTHIREEKMRTNRSSKTRWSFIEACSSCSGEE 277 +L+ +++VY + ++ + EK N S +T +S CS SG+E Sbjct: 187 QLVDALEVYNQRKNGELIVHSEKSVKNTSPQTLFSSCTECSCSSGKE 233
>STOX1_HUMAN (Q6ZVD7) Storkhead-box protein 1 (Winged helix domain-containing| protein) Length = 989 Score = 30.4 bits (67), Expect = 2.0 Identities = 19/76 (25%), Positives = 32/76 (42%), Gaps = 2/76 (2%) Frame = +2 Query: 77 RTYHTG--YRLTNPSTIDITPPELITSMQVYTRMESTRTHIREEKMRTNRSSKTRWSFIE 250 + YHTG Y + P T IT T + + + ++ R +S T +E Sbjct: 176 KIYHTGEGYFIVTPQTYFITN----------TTTQENKRMLPSDESRLMPASMTYLVSME 225 Query: 251 ACSSCSGEEGTPLGHC 298 +C+ + E P+ HC Sbjct: 226 SCAESAQENAAPISHC 241
>NPT2B_MOUSE (Q9DBP0) Sodium-dependent phosphate transport protein 2B| (Sodium/phosphate cotransporter 2B) (Na(+)/Pi cotransporter 2B) (Sodium-phosphate transport protein 2B) (Na(+)-dependent phosphate cotransporter 2B) (NaPi-2b) (Solute carrier family 34 Length = 697 Score = 29.6 bits (65), Expect = 3.5 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = -3 Query: 118 CARVG*AVACMICTCNNALACHCLASVLDYGNEE 17 C RV V CM+C C C C D G EE Sbjct: 621 CCRVCCRVCCMVCGCK---CCRCSKCCRDQGEEE 651
>SAN1_YEAST (P22470) Protein SAN1| Length = 610 Score = 29.3 bits (64), Expect = 4.5 Identities = 17/53 (32%), Positives = 22/53 (41%) Frame = +1 Query: 40 LKPSNGTPMHYYTYISYRLPPNQPEHN*HYSTGTHNQYASIHKNGIHKNTHPR 198 L P NG P+H RLPPN + N + Q + G + N PR Sbjct: 359 LVPQNGQPLHN----PVRLPPNDSDRNGVNGPSSTTQNPPSNSGGSNNNQSPR 407
>HSLV_BUCAP (Q8K906) ATP-dependent protease hslV (EC 3.4.25.-)| Length = 175 Score = 28.9 bits (63), Expect = 5.9 Identities = 11/33 (33%), Positives = 23/33 (69%) Frame = -3 Query: 406 LLAMTMANRHILGGAGRITMGHSSSSSNQGRIR 308 +L++ + N+ ++GG G+ T+G++ SN +IR Sbjct: 3 ILSVRLKNKVVIGGDGQATLGNTIMKSNVKKIR 35
>HSLV_BUCAI (P57115) ATP-dependent protease hslV (EC 3.4.25.-)| Length = 175 Score = 28.9 bits (63), Expect = 5.9 Identities = 11/33 (33%), Positives = 23/33 (69%) Frame = -3 Query: 406 LLAMTMANRHILGGAGRITMGHSSSSSNQGRIR 308 +L++ + N+ ++GG G+ T+G++ SN +IR Sbjct: 3 ILSVRLKNKVVIGGDGQATLGNTIMKSNVKKIR 35
>KGP24_DROME (Q03043) cGMP-dependent protein kinase, isozyme 2 forms| cD4/T1/T3A/T3B (EC 2.7.11.12) (CGK) (Foraging protein) Length = 1088 Score = 28.9 bits (63), Expect = 5.9 Identities = 18/48 (37%), Positives = 22/48 (45%), Gaps = 3/48 (6%) Frame = +1 Query: 106 QPEHN*HYSTGTHNQYASIHKNGIHKNTHPRGKN---ENKSFLQNKMV 240 Q E N +Y T SI N + NTHP G N N S + N +V Sbjct: 171 QQEPNANYQFPTDLGLVSIVNNNNNTNTHPSGSNSGSNNNSNINNNLV 218
>HISX_ACIAD (Q6FEC8) Histidinol dehydrogenase (EC 1.1.1.23) (HDH)| Length = 430 Score = 28.9 bits (63), Expect = 5.9 Identities = 14/61 (22%), Positives = 33/61 (54%), Gaps = 2/61 (3%) Frame = +2 Query: 113 STIDITPPELITSMQVYTRMESTRTHIREEKMRTNRSSKTR--WSFIEACSSCSGEEGTP 286 S +++T +L T+ + T + E++R+ ++ + WS+++A + G++ TP Sbjct: 65 SDLELTQEQLKTAFEALTAEIREALELAAERIRSFHQAQKQEGWSYVDALGNTLGQKVTP 124 Query: 287 L 289 L Sbjct: 125 L 125
>KARG_ANTJA (O15992) Arginine kinase (EC 2.7.3.3) (AK)| Length = 715 Score = 28.5 bits (62), Expect = 7.7 Identities = 15/53 (28%), Positives = 26/53 (49%) Frame = +2 Query: 71 ITRTYHTGYRLTNPSTIDITPPELITSMQVYTRMESTRTHIREEKMRTNRSSK 229 I YH+ Y+L N T D+ P ++ ++ T+IR ++R R+ K Sbjct: 441 IVEDYHSPYKLANKHTSDMNPEKVDA-----PNLDPEGTYIRSTRIRVARNVK 488
>FLGH_PHOPR (Q6LTQ7) Flagellar L-ring protein precursor (Basal body L-ring| protein) Length = 256 Score = 28.5 bits (62), Expect = 7.7 Identities = 13/35 (37%), Positives = 21/35 (60%) Frame = +1 Query: 97 PPNQPEHN*HYSTGTHNQYASIHKNGIHKNTHPRG 201 P +PEH Y+T T + ++SI ++ +T PRG Sbjct: 69 PQAKPEH---YATATGSLFSSIQAQDLYDDTKPRG 100 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 56,414,751 Number of Sequences: 219361 Number of extensions: 1080525 Number of successful extensions: 2971 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 2914 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2970 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2628831825 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)