ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbastl30h01 |
|---|---|
| Clone Library Name | barley_pub |
>PHOT1_ARATH (O48963) Phototropin-1 (EC 2.7.11.1) (Non-phototropic hypocotyl| protein 1) (Root phototropism protein 1) Length = 996 Score = 42.0 bits (97), Expect = 7e-04 Identities = 20/45 (44%), Positives = 30/45 (66%), Gaps = 2/45 (4%) Frame = -3 Query: 444 FRGINWALVRGTAPPKLDAPLFSKDV--GKGMGDAAAADNGTDMF 316 F+GINWAL+R T PP+L+ P+FS + G+ + D D T++F Sbjct: 952 FKGINWALIRCTNPPELETPIFSGEAENGEKVVDPELEDLQTNVF 996
>PHOT2_ARATH (P93025) Phototropin-2 (EC 2.7.11.1) (Defective in chloroplast| avoidance protein 1) (Non phototropic hypocotyl 1-like protein 1) (NPH1-like 1) (AtKin7) Length = 915 Score = 40.8 bits (94), Expect = 0.002 Identities = 19/39 (48%), Positives = 23/39 (58%) Frame = -3 Query: 444 FRGINWALVRGTAPPKLDAPLFSKDVGKGMGDAAAADNG 328 FRGINW L+RG +PP LDAPL + D D+G Sbjct: 864 FRGINWPLIRGMSPPPLDAPLSIIEKDPNAKDIKWEDDG 902
>KPK7_ARATH (Q05999) Putative serine/threonine-protein kinase PK7 (EC 2.7.11.1)| Length = 578 Score = 31.6 bits (70), Expect = 0.93 Identities = 11/25 (44%), Positives = 18/25 (72%) Frame = -3 Query: 444 FRGINWALVRGTAPPKLDAPLFSKD 370 F+ +NWAL+R T+PP++ P+ D Sbjct: 516 FQSVNWALIRCTSPPQIPQPVKPMD 540
>XBP1_HUMAN (P17861) X box-binding protein 1 (XBP-1) (Tax-responsive| element-binding protein 5) Length = 261 Score = 31.6 bits (70), Expect = 0.93 Identities = 17/61 (27%), Positives = 33/61 (54%), Gaps = 2/61 (3%) Frame = +2 Query: 20 ISLYIFSIFWGLRCRSSISCW*FWKTMHLNCLFNMIP--IQDYSTALNNSSAYSISYRPN 193 IS +I ++ L+ +S ISCW FW T +C N +P + + ++ ++ + Y+P Sbjct: 186 ISPWILAVLT-LQIQSLISCWAFWTTWTQSCSSNALPQSLPAWRSSQRSTQKDPVPYQPP 244 Query: 194 Y 196 + Sbjct: 245 F 245
>EDG3_MOUSE (Q9Z0U9) Sphingosine 1-phosphate receptor Edg-3 (S1P receptor| Edg-3) (Endothelial differentiation G-protein coupled receptor 3) (Sphingosine 1-phosphate receptor 3) (S1P3) (Lysophospholipid receptor B3) Length = 378 Score = 31.2 bits (69), Expect = 1.2 Identities = 20/66 (30%), Positives = 27/66 (40%), Gaps = 3/66 (4%) Frame = -1 Query: 392 TLHCFPRTWAREWAMLPPPIMAPTCSERRRWMERHAKDVVSRPCSLNHGSCV---VGCCW 222 T P W + + A TCS +ERH + RP N V +G CW Sbjct: 104 TFSLSPTVWFLREGSMFVALGASTCSLLAIAIERHLTMIKMRPYDANKKHRVFLLIGMCW 163 Query: 221 LFSFSV 204 L +FS+ Sbjct: 164 LIAFSL 169
>G11A_ORYSA (P47997) Protein kinase G11A (EC 2.7.11.1)| Length = 589 Score = 30.8 bits (68), Expect = 1.6 Identities = 10/21 (47%), Positives = 16/21 (76%) Frame = -3 Query: 444 FRGINWALVRGTAPPKLDAPL 382 F G+NWAL+R +PP++ P+ Sbjct: 533 FEGVNWALIRCASPPEVPRPV 553
>TT1_ARATH (Q8VWG3) TRANSPARENT TESTA 1 protein (Zinc finger protein TT1)| (TTL1) Length = 303 Score = 30.8 bits (68), Expect = 1.6 Identities = 20/60 (33%), Positives = 27/60 (45%), Gaps = 9/60 (15%) Frame = +3 Query: 213 RKQPATTNNTRPMIERARPRYY-IFGMSFH-------PPSSFRTCRCHYRRRQ-HRPFPC 365 RK P + T+P P Y + G H P FRT + HY+R+ H+PF C Sbjct: 172 RKGPESLKGTQPRAMLGIPCYCCVEGCRNHIDHPRSKPLKDFRTLQTHYKRKHGHKPFSC 231
>PGCA_HUMAN (P16112) Aggrecan core protein precursor (Cartilage-specific| proteoglycan core protein) (CSPCP) (Chondroitin sulfate proteoglycan core protein 1) [Contains: Aggrecan core protein 2] Length = 2415 Score = 30.4 bits (67), Expect = 2.1 Identities = 14/26 (53%), Positives = 18/26 (69%) Frame = +3 Query: 354 PFPCPRPWKTVERPASEEPCRAQEPS 431 PFP RP+ +VE SEEP ++EPS Sbjct: 804 PFPSVRPFPSVELFPSEEPFPSKEPS 829
>RFNG_HUMAN (Q9Y644) Beta-1,3-N-acetylglucosaminyltransferase radical fringe| (EC 2.4.1.222) (O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase) Length = 331 Score = 30.0 bits (66), Expect = 2.7 Identities = 16/47 (34%), Positives = 20/47 (42%) Frame = +3 Query: 144 PLRSTTPALIPSPTVLTTSTNRKRKQPATTNNTRPMIERARPRYYIF 284 P R P+L P + T RK P R I RAR + +IF Sbjct: 47 PSRPAAPSLRPDDVFIAVKTTRKNHGPRLRLLLRTWISRARQQTFIF 93
>EDG3_HUMAN (Q99500) Sphingosine 1-phosphate receptor Edg-3 (S1P receptor| Edg-3) (Endothelial differentiation G-protein coupled receptor 3) (Sphingosine 1-phosphate receptor 3) (S1P3) Length = 378 Score = 30.0 bits (66), Expect = 2.7 Identities = 19/66 (28%), Positives = 27/66 (40%), Gaps = 3/66 (4%) Frame = -1 Query: 392 TLHCFPRTWAREWAMLPPPIMAPTCSERRRWMERHAKDVVSRPCSLNHGSCV---VGCCW 222 T P W + + A TCS +ERH + RP N V +G CW Sbjct: 103 TFSLSPTVWFLREGSMFVALGASTCSLLAIAIERHLTMIKMRPYDANKRHRVFLLIGMCW 162 Query: 221 LFSFSV 204 L +F++ Sbjct: 163 LIAFTL 168
>IL21R_HUMAN (Q9HBE5) Interleukin-21 receptor precursor (IL-21R) (Novel| interleukin receptor) Length = 538 Score = 29.6 bits (65), Expect = 3.5 Identities = 8/18 (44%), Positives = 15/18 (83%) Frame = -1 Query: 377 PRTWAREWAMLPPPIMAP 324 PR++ R+W ++PPP+ +P Sbjct: 516 PRSYLRQWVVIPPPLSSP 533
>KI18A_HUMAN (Q8NI77) Kinesin family member 18A| Length = 898 Score = 29.6 bits (65), Expect = 3.5 Identities = 11/27 (40%), Positives = 20/27 (74%) Frame = +3 Query: 162 PALIPSPTVLTTSTNRKRKQPATTNNT 242 P+++PS +TT+ RKRK ++T+N+ Sbjct: 814 PSMVPSYMAMTTAAKRKRKLTSSTSNS 840
>LSP2_DROME (Q24388) Larval serum protein 2 precursor (LSP-2) (Hexamerin 2)| Length = 701 Score = 29.6 bits (65), Expect = 3.5 Identities = 16/60 (26%), Positives = 23/60 (38%) Frame = +3 Query: 180 PTVLTTSTNRKRKQPATTNNTRPMIERARPRYYIFGMSFHPPSSFRTCRCHYRRRQHRPF 359 P LTT + N P +E + Y FG + H S + +R H+PF Sbjct: 448 PESLTTYFEHFDSDISNAVNVEPAVEGSADPLYTFGRNSHYKGSSYVIKARQQRLNHKPF 507
>POLN_EEVVM (Q9WJC7) Nonstructural polyprotein (Polyprotein nsP1234) (P1234)| [Contains: P123; P123'; mRNA capping enzyme nsP1 (EC 2.1.1.-) (EC 2.7.7.-) (Nonstructural protein 1); Protease/triphosphatase/NTPase/helicase nsP2 (EC 3.4.22.-) (EC 3.1.3.33) (EC Length = 2498 Score = 29.3 bits (64), Expect = 4.6 Identities = 12/31 (38%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Frame = -1 Query: 305 RWMERHAKDVVS-RPCSLNHGSCVVGCCWLF 216 RW + + +D RP L V+GCCW F Sbjct: 393 RWAKEYKEDQEDERPLGLRDRQLVMGCCWAF 423
>SEL1L_HUMAN (Q9UBV2) Sel-1 homolog precursor (Suppressor of lin-12-like| protein) (Sel-1L) Length = 794 Score = 29.3 bits (64), Expect = 4.6 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = +3 Query: 333 YRRRQHRPFPCPRPWKTVERPASEEPCRAQEP 428 YR+RQH+ P PRP P +E Q+P Sbjct: 761 YRQRQHQDMPAPRPPGPRPAPPQQEGPPEQQP 792
>POLN_EEVV3 (P36327) Nonstructural polyprotein (Polyprotein nsP1234) (P1234)| [Contains: P123; P123'; mRNA capping enzyme nsP1 (EC 2.1.1.-) (EC 2.7.7.-) (Nonstructural protein 1); Protease/triphosphatase/NTPase/helicase nsP2 (EC 3.4.22.-) (EC 3.1.3.33) (EC Length = 2485 Score = 29.3 bits (64), Expect = 4.6 Identities = 12/31 (38%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Frame = -1 Query: 305 RWMERHAKDVVS-RPCSLNHGSCVVGCCWLF 216 RW + + +D RP L V+GCCW F Sbjct: 393 RWAKEYKEDQEDERPLGLRDRQLVMGCCWAF 423
>FKS26_MOUSE (Q8R3L2) Protein FKSG26| Length = 676 Score = 29.3 bits (64), Expect = 4.6 Identities = 25/76 (32%), Positives = 34/76 (44%), Gaps = 2/76 (2%) Frame = +3 Query: 138 ITPLRSTTPALIPSPTVLTTSTNRKRKQPATTNNTRPMIERARPRYYIFGMSFHPPSSFR 317 I L T+P + S L+ + + Q R +IERA Y +FHP S Sbjct: 275 IVVLLQTSPYHVDSLLQLSDACRFQEDQEMA----RDLIERA---LYSMECAFHPLFSLT 327 Query: 318 --TCRCHYRRRQHRPF 359 TCR YRR ++R F Sbjct: 328 SGTCRLDYRRPENRSF 343
>FA53B_HUMAN (Q14153) Protein FAM53B| Length = 422 Score = 29.3 bits (64), Expect = 4.6 Identities = 13/42 (30%), Positives = 22/42 (52%) Frame = +3 Query: 144 PLRSTTPALIPSPTVLTTSTNRKRKQPATTNNTRPMIERARP 269 P ++TPA P ++ +R R QP N+ + ++R RP Sbjct: 244 PSANSTPASTPELARRSSGLSRSRSQPCVLNDKKVGVKRRRP 285
>POLN_EEVVT (P27282) Nonstructural polyprotein (Polyprotein nsP1234) (P1234)| [Contains: P123; P123'; mRNA capping enzyme nsP1 (EC 2.1.1.-) (EC 2.7.7.-) (Nonstructural protein 1); Protease/triphosphatase/NTPase/helicase nsP2 (EC 3.4.22.-) (EC 3.1.3.33) (EC Length = 2492 Score = 29.3 bits (64), Expect = 4.6 Identities = 12/31 (38%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Frame = -1 Query: 305 RWMERHAKDVVS-RPCSLNHGSCVVGCCWLF 216 RW + + +D RP L V+GCCW F Sbjct: 393 RWAKEYKEDQEDERPLGLRDRQLVMGCCWAF 423
>POLN_EEVVP (P36328) Nonstructural polyprotein (Polyprotein nsP1234) (P1234)| [Contains: P123; P123'; mRNA capping enzyme nsP1 (EC 2.1.1.-) (EC 2.7.7.-) (Nonstructural protein 1); Protease/triphosphatase/NTPase/helicase nsP2 (EC 3.4.22.-) (EC 3.1.3.33) (EC Length = 2492 Score = 29.3 bits (64), Expect = 4.6 Identities = 12/31 (38%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Frame = -1 Query: 305 RWMERHAKDVVS-RPCSLNHGSCVVGCCWLF 216 RW + + +D RP L V+GCCW F Sbjct: 393 RWAKEYKEDQEDERPLGLRDRQLVMGCCWAF 423
>POLN_EEVVC (Q8V294) Nonstructural polyprotein (Polyprotein nsP1234) (P1234)| [Contains: P123; P123'; mRNA capping enzyme nsP1 (EC 2.1.1.-) (EC 2.7.7.-) (Nonstructural protein 1); Protease/triphosphatase/NTPase/helicase nsP2 (EC 3.4.22.-) (EC 3.1.3.33) (EC Length = 2496 Score = 29.3 bits (64), Expect = 4.6 Identities = 12/31 (38%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Frame = -1 Query: 305 RWMERHAKDVVS-RPCSLNHGSCVVGCCWLF 216 RW + + +D RP L V+GCCW F Sbjct: 393 RWAKEYKEDQEDERPLGLRDRQLVMGCCWAF 423
>SEL1L_RAT (Q80Z70) Sel-1 homolog precursor (Suppressor of lin-12-like| protein) (Sel-1L) Length = 794 Score = 28.9 bits (63), Expect = 6.0 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = +3 Query: 333 YRRRQHRPFPCPRPWKTVERPASEEPCRAQEP 428 YR+RQH+ P PRP P +E Q+P Sbjct: 761 YRQRQHQDIPVPRPPGPRPAPPQQEGPPEQQP 792
>SEL1L_MOUSE (Q9Z2G6) Sel-1 homolog precursor (Suppressor of lin-12-like| protein) (Sel-1L) Length = 790 Score = 28.9 bits (63), Expect = 6.0 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = +3 Query: 333 YRRRQHRPFPCPRPWKTVERPASEEPCRAQEP 428 YR+RQH+ P PRP P +E Q+P Sbjct: 757 YRQRQHQDIPVPRPPGPRPAPPQQEGPPEQQP 788
>GLMS_SYNEL (Q8DJI6) Glucosamine--fructose-6-phosphate aminotransferase| [isomerizing] (EC 2.6.1.16) (Hexosephosphate aminotransferase) (D-fructose-6-phosphate amidotransferase) (GFAT) (L-glutamine-D-fructose-6-phosphate amidotransferase) (Glucosamine-6-ph Length = 625 Score = 28.5 bits (62), Expect = 7.9 Identities = 23/82 (28%), Positives = 33/82 (40%), Gaps = 19/82 (23%) Frame = +3 Query: 153 STTPALIP----------------SPT---VLTTSTNRKRKQPATTNNTRPMIERARPRY 275 S TPA+IP +PT V +R RK P T N M+E+ ++ Sbjct: 195 SDTPAIIPYTRAVLPLENGELARLTPTGVEVYDFEGHRLRKTPRTLNWNPVMVEKQGFKH 254 Query: 276 YIFGMSFHPPSSFRTCRCHYRR 341 Y+ + P R C +Y R Sbjct: 255 YMLKEIYEQPGVVRACLENYLR 276
>SEL1L_MESAU (Q9ESM7) Sel-1 homolog precursor (Suppressor of lin-12-like| protein) (Sel-1L) Length = 794 Score = 28.5 bits (62), Expect = 7.9 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = +3 Query: 333 YRRRQHRPFPCPRPWKTVERPASEEPCRAQEP 428 YR+RQH+ P PRP P +E Q+P Sbjct: 761 YRQRQHQDVPVPRPPGPWPAPPQQEGPPEQQP 792
>POLN_EEEVF (Q4QXJ8) Nonstructural polyprotein (Polyprotein nsP1234) (P1234)| [Contains: P123; P123'; mRNA capping enzyme nsP1 (EC 2.1.1.-) (EC 2.7.7.-) (Nonstructural protein 1); Protease/triphosphatase/NTPase/helicase nsP2 (EC 3.4.22.-) (EC 3.1.3.33) (EC Length = 2493 Score = 28.5 bits (62), Expect = 7.9 Identities = 14/42 (33%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Frame = -1 Query: 338 PIMAPTCSERRRWMERHAKDVVS-RPCSLNHGSCVVGCCWLF 216 P++A S RW H D+ + + S V+GCCW F Sbjct: 383 PVVAQAFS---RWAREHRADLEDEKGLGVRERSLVMGCCWAF 421
>ZN646_HUMAN (O15015) Zinc finger protein 646| Length = 1829 Score = 28.5 bits (62), Expect = 7.9 Identities = 17/72 (23%), Positives = 35/72 (48%) Frame = +3 Query: 162 PALIPSPTVLTTSTNRKRKQPATTNNTRPMIERARPRYYIFGMSFHPPSSFRTCRCHYRR 341 P++ P+P +L +T+++ + P TT + RP + G ++ S R +R Sbjct: 436 PSVPPAPLLLAETTHKEEEDPTTTLDHRPY------KCSECGRAYRHRGSLVNHRHSHRT 489 Query: 342 RQHRPFPCPRPW 377 +++ CPR + Sbjct: 490 GEYQCSLCPRKY 501
>MAP4_HUMAN (P27816) Microtubule-associated protein 4 (MAP 4)| Length = 1152 Score = 28.5 bits (62), Expect = 7.9 Identities = 18/57 (31%), Positives = 27/57 (47%), Gaps = 3/57 (5%) Frame = +3 Query: 111 AYLI*SRYKITPLRS---TTPALIPSPTVLTTSTNRKRKQPATTNNTRPMIERARPR 272 A ++ SR K TP+ S TTP + PT S+ R TN + P ++ R + Sbjct: 882 AGVVPSRVKATPMPSRPSTTPFIDKKPTSAKPSSTTPRLSRLATNTSAPDLKNVRSK 938
>KPK1_PHAVU (P15792) Protein kinase PVPK-1 (EC 2.7.11.1)| Length = 609 Score = 28.5 bits (62), Expect = 7.9 Identities = 12/32 (37%), Positives = 19/32 (59%), Gaps = 5/32 (15%) Frame = -3 Query: 444 FRGINWALVRGTAPPK-----LDAPLFSKDVG 364 F+ +NWAL+R PP+ ++ P KD+G Sbjct: 565 FQNVNWALIRCATPPEVPRQVINLPQTEKDLG 596 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 64,274,557 Number of Sequences: 219361 Number of extensions: 1293631 Number of successful extensions: 4532 Number of sequences better than 10.0: 29 Number of HSP's better than 10.0 without gapping: 4081 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4498 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2677159704 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
