| Clone Name | rbastl30g12 |
|---|---|
| Clone Library Name | barley_pub |
>EGFR_DROME (P04412) Epidermal growth factor receptor precursor (EC 2.7.10.1)| (Egfr) (Gurken receptor) (Protein torpedo) (Drosophila relative of ERBB) Length = 1426 Score = 30.0 bits (66), Expect = 1.6 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = -2 Query: 158 LNMLPGGSFCCSCHPACMLGTNNFWHKTV 72 L L G + C CHP C L TN +H+ V Sbjct: 728 LKPLAGRAVCRKCHPLCELCTNYGYHEQV 756
>HOLB_BUCAP (Q8K9J2) DNA polymerase III delta' subunit (EC 2.7.7.7)| Length = 328 Score = 29.3 bits (64), Expect = 2.8 Identities = 17/41 (41%), Positives = 25/41 (60%), Gaps = 3/41 (7%) Frame = -2 Query: 173 LSKPILNMLPGGS-FCCSCHPACMLGTNNF--WHKTVINLK 60 +SK +L + P G+ FC +CH ++ NN WH T+IN K Sbjct: 44 ISKWLLCLKPKGTNFCDNCHGCKLMSANNHPDWH-TIINEK 83
>AT1A1_CHICK (P09572) Sodium/potassium-transporting ATPase alpha-1 chain| precursor (EC 3.6.3.9) (Sodium pump 1) (Na+/K+ ATPase 1) Length = 1021 Score = 28.9 bits (63), Expect = 3.6 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = -1 Query: 261 MVEGQNLSPQLQLGLAMVCCLAATGCYDYFVE 166 ++EG+ S L LG+ + + TGC+ Y+ E Sbjct: 118 VMEGEPNSDNLYLGVVLAAVVIITGCFSYYQE 149
>RTP3_HUMAN (Q9BQQ7) Receptor-transporting protein 3 (Transmembrane protein 7)| Length = 232 Score = 28.5 bits (62), Expect = 4.7 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = -3 Query: 172 CRNRS*ICCLVVLFVAVVIL 113 CRN S CC V+L V VVI+ Sbjct: 208 CRNLSIFCCCVILIVIVVIV 227
>TRIO_HUMAN (O75962) Triple functional domain protein (PTPRF-interacting| protein) Length = 3038 Score = 28.1 bits (61), Expect = 6.2 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = -2 Query: 167 KPILNMLPGGSFCCSCHPACMLGTNNFWHKTVIN 66 KP+L +L SF C H A ++ +NFW K N Sbjct: 80 KPLLKILQE-SFPCCIHVALIIKPDNFWQKQRTN 112
>BC10_RAT (P62950) Bladder cancer-associated protein (Bladder cancer 10 kDa| protein) (Bc10) Length = 87 Score = 27.7 bits (60), Expect = 8.1 Identities = 15/49 (30%), Positives = 22/49 (44%) Frame = -3 Query: 247 KPFTPVTIRLGHGLLLGSNRMLRLFCRNRS*ICCLVVLFVAVVILHACW 101 KP P + H + +G + L R IC LV L +I ++CW Sbjct: 15 KPLNPA-LWFSHSMFMGFYLLSFLLERKPCTICALVFLAALFLICYSCW 62
>BC10_PONPY (Q5R692) Bladder cancer-associated protein homolog (Bladder cancer| 10 kDa protein homolog) (Bc10) Length = 87 Score = 27.7 bits (60), Expect = 8.1 Identities = 15/49 (30%), Positives = 22/49 (44%) Frame = -3 Query: 247 KPFTPVTIRLGHGLLLGSNRMLRLFCRNRS*ICCLVVLFVAVVILHACW 101 KP P + H + +G + L R IC LV L +I ++CW Sbjct: 15 KPLNPA-LWFSHSMFMGFYLLSFLLERKPCTICALVFLAALFLICYSCW 62
>BC10_MOUSE (P62951) Bladder cancer-associated protein (Bladder cancer 10 kDa| protein) (Bc10) Length = 87 Score = 27.7 bits (60), Expect = 8.1 Identities = 15/49 (30%), Positives = 22/49 (44%) Frame = -3 Query: 247 KPFTPVTIRLGHGLLLGSNRMLRLFCRNRS*ICCLVVLFVAVVILHACW 101 KP P + H + +G + L R IC LV L +I ++CW Sbjct: 15 KPLNPA-LWFSHSMFMGFYLLSFLLERKPCTICALVFLAALFLICYSCW 62
>BC10_HUMAN (P62952) Bladder cancer-associated protein (Bladder cancer 10 kDa| protein) (Bc10) Length = 87 Score = 27.7 bits (60), Expect = 8.1 Identities = 15/49 (30%), Positives = 22/49 (44%) Frame = -3 Query: 247 KPFTPVTIRLGHGLLLGSNRMLRLFCRNRS*ICCLVVLFVAVVILHACW 101 KP P + H + +G + L R IC LV L +I ++CW Sbjct: 15 KPLNPA-LWFSHSMFMGFYLLSFLLERKPCTICALVFLAALFLICYSCW 62
>BC10_FELCA (P62953) Bladder cancer-associated protein (Bladder cancer 10 kDa| protein) (Bc10) Length = 87 Score = 27.7 bits (60), Expect = 8.1 Identities = 15/49 (30%), Positives = 22/49 (44%) Frame = -3 Query: 247 KPFTPVTIRLGHGLLLGSNRMLRLFCRNRS*ICCLVVLFVAVVILHACW 101 KP P + H + +G + L R IC LV L +I ++CW Sbjct: 15 KPLNPA-LWFSHSMFMGFYLLSFLLERKPCTICALVFLAALFLICYSCW 62
>BC10_BOVIN (P62954) Bladder cancer-associated protein| Length = 87 Score = 27.7 bits (60), Expect = 8.1 Identities = 15/49 (30%), Positives = 22/49 (44%) Frame = -3 Query: 247 KPFTPVTIRLGHGLLLGSNRMLRLFCRNRS*ICCLVVLFVAVVILHACW 101 KP P + H + +G + L R IC LV L +I ++CW Sbjct: 15 KPLNPA-LWFSHSMFMGFYLLSFLLERKPCTICALVFLAALFLICYSCW 62
>HRS_DROME (Q960X8) Hepatocyte growth factor-regulated tyrosine kinase| substrate Length = 760 Score = 25.0 bits (53), Expect(2) = 9.7 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +1 Query: 85 QKLLVPNMHAG*QLQQKEPPGN 150 Q+ + PN+ G +QQ PPGN Sbjct: 593 QQPMPPNLQPGGLMQQPAPPGN 614 Score = 20.8 bits (42), Expect(2) = 9.7 Identities = 7/18 (38%), Positives = 10/18 (55%) Frame = +3 Query: 45 HGSQKFEINNCFMPKIVG 98 HGS ++NN + P G Sbjct: 544 HGSPSHQLNNVYNPYAAG 561 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 42,068,757 Number of Sequences: 219361 Number of extensions: 789505 Number of successful extensions: 2405 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 2315 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2405 length of database: 80,573,946 effective HSP length: 63 effective length of database: 66,754,203 effective search space used: 1602100872 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)