Clone Name | rbastl30g08 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | OR3A2_PANTR (Q9TU97) Olfactory receptor 3A2 | 31 | 1.2 | 2 | BRAF_PSEAE (P21629) High-affinity branched-chain amino acid tran... | 30 | 2.7 | 3 | SEY1_YARLI (Q6C3B0) Protein SEY1 | 30 | 3.5 | 4 | VWF_CANFA (Q28295) Von Willebrand factor precursor (vWF) | 28 | 7.7 |
---|
>OR3A2_PANTR (Q9TU97) Olfactory receptor 3A2| Length = 315 Score = 31.2 bits (69), Expect = 1.2 Identities = 20/49 (40%), Positives = 26/49 (53%), Gaps = 5/49 (10%) Frame = -1 Query: 203 ACGSLRRGSASSWQSVLTCCVSHVGVVGLMCLFFG----RYMR-GAEQS 72 A LR S W+ + C SH+ VV CLFFG YMR G+E++ Sbjct: 225 AAAVLRIRSVEGWKKAFSTCGSHLTVV---CLFFGTGIFNYMRLGSEEA 270
>BRAF_PSEAE (P21629) High-affinity branched-chain amino acid transport| ATP-binding protein braF Length = 255 Score = 30.0 bits (66), Expect = 2.7 Identities = 19/69 (27%), Positives = 29/69 (42%) Frame = +2 Query: 62 RSYKTVLLRAYNDRKTNTSVRQHRHVTRNTLKRSAKTTPTLSSASHKLSYSELLYSAATV 241 R+++ V L N V QHRH+ N L KT S + Y+ + Sbjct: 84 RTFQNVRLFKEMTAVENLLVAQHRHLNTNFLAGLFKTPAFRRSEREAMEYAAHWLEEVNL 143 Query: 242 SQHRNKSAG 268 ++ N+SAG Sbjct: 144 TEFANRSAG 152
>SEY1_YARLI (Q6C3B0) Protein SEY1| Length = 938 Score = 29.6 bits (65), Expect = 3.5 Identities = 18/54 (33%), Positives = 25/54 (46%) Frame = +2 Query: 122 RQHRHVTRNTLKRSAKTTPTLSSASHKLSYSELLYSAATVSQHRNKSAGGSVAG 283 R+H+ V R + A+ + SS HK + + A SQ KS GS AG Sbjct: 109 REHKPVERKPVSSPAEKSIPASSPVHKAAPTPAASHAVPTSQKSAKSTPGSYAG 162
>VWF_CANFA (Q28295) Von Willebrand factor precursor (vWF)| Length = 2813 Score = 28.5 bits (62), Expect = 7.7 Identities = 10/19 (52%), Positives = 14/19 (73%) Frame = +1 Query: 115 ISPTTPTCDTQHVKTLCQD 171 +SP T TC + HVK +CQ+ Sbjct: 305 VSPCTRTCQSLHVKEVCQE 323 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 52,489,644 Number of Sequences: 219361 Number of extensions: 839103 Number of successful extensions: 2425 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2342 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2424 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2618960580 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)