Clone Name | rbastl30f11 |
---|---|
Clone Library Name | barley_pub |
>LOX1_ORYSA (Q76I22) Lipoxygenase 1 (EC 1.13.11.12) (9-lipoxygenase) (r9-LOX1)| Length = 863 Score = 30.0 bits (66), Expect = 1.6 Identities = 13/15 (86%), Positives = 15/15 (100%) Frame = -2 Query: 297 AEGLSARGIPNSISI 253 AEG++ARGIPNSISI Sbjct: 849 AEGITARGIPNSISI 863
>LOX2_ORYSA (P29250) Lipoxygenase 2 (EC 1.13.11.12) (Lipoxygenase L-2)| Length = 870 Score = 29.6 bits (65), Expect = 2.0 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -2 Query: 297 AEGLSARGIPNSISI 253 A GLSARGIPNSISI Sbjct: 856 AAGLSARGIPNSISI 870
>LOX2_SOYBN (P09439) Seed lipoxygenase-2 (EC 1.13.11.12) (L-2)| Length = 865 Score = 28.1 bits (61), Expect = 5.9 Identities = 12/15 (80%), Positives = 14/15 (93%) Frame = -2 Query: 297 AEGLSARGIPNSISI 253 +EGL+ RGIPNSISI Sbjct: 851 SEGLTCRGIPNSISI 865
>NOTC2_MOUSE (O35516) Neurogenic locus notch homolog protein 2 precursor (Notch| 2) (Motch B) [Contains: Notch 2 extracellular truncation; Notch 2 intracellular domain] Length = 2470 Score = 28.1 bits (61), Expect = 5.9 Identities = 16/53 (30%), Positives = 25/53 (47%), Gaps = 7/53 (13%) Frame = -2 Query: 180 CVCV-------CDRELCRCMNN*GNKGACTTGLIGMRKLSSAGYRSMHRRVQK 43 C+C C ++ C++N G CT GL G + L AG+ ++ V K Sbjct: 704 CICPEGPHHPSCYSQVNECLSNPCIHGNCTGGLSGYKCLCDAGWVGVNCEVDK 756
>NOTC2_HUMAN (Q04721) Neurogenic locus notch homolog protein 2 precursor (Notch| 2) (hN2) [Contains: Notch 2 extracellular truncation; Notch 2 intracellular domain] Length = 2471 Score = 28.1 bits (61), Expect = 5.9 Identities = 16/53 (30%), Positives = 25/53 (47%), Gaps = 7/53 (13%) Frame = -2 Query: 180 CVCV-------CDRELCRCMNN*GNKGACTTGLIGMRKLSSAGYRSMHRRVQK 43 C+C C ++ C++N G CT GL G + L AG+ ++ V K Sbjct: 706 CICPEGPHHPSCYSQVNECLSNPCIHGNCTGGLSGYKCLCDAGWVGINCEVDK 758
>CB024_HUMAN (Q9BV87) Protein C2orf24| Length = 410 Score = 27.7 bits (60), Expect = 7.8 Identities = 18/65 (27%), Positives = 30/65 (46%), Gaps = 5/65 (7%) Frame = -2 Query: 264 SISI*SEHVRRRDLMLLCYPCLLTPELACVCVCDRELC-----RCMNN*GNKGACTTGLI 100 ++++ S V + L L C P P+L C E C +C+ + N +C G + Sbjct: 244 ALAVASVAVIHQSLGLSCTPTPGPPDLGLTSRCLLEPCIPSVPQCLPSPANVSSCLEGSM 303 Query: 99 GMRKL 85 G+R L Sbjct: 304 GLRSL 308
>LOX1_LENCU (P38414) Lipoxygenase (EC 1.13.11.12)| Length = 866 Score = 27.7 bits (60), Expect = 7.8 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -2 Query: 294 EGLSARGIPNSISI 253 EGL+ RGIPNSISI Sbjct: 853 EGLTCRGIPNSISI 866 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 44,866,989 Number of Sequences: 219361 Number of extensions: 784407 Number of successful extensions: 1979 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1917 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1977 length of database: 80,573,946 effective HSP length: 74 effective length of database: 64,341,232 effective search space used: 1544189568 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)