| Clone Name | rbastl30f07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | AMPD3_RAT (O09178) AMP deaminase 3 (EC 3.5.4.6) (AMP deaminase i... | 30 | 3.6 | 2 | CLS2_CAEEL (P32744) Kinetochore protein CLASP-2 | 29 | 4.7 | 3 | KR74_ICHV1 (Q00095) Gene 74 protein kinase (EC 2.7.11.1) | 29 | 6.2 | 4 | DRD1_DIDMA (P42288) D(1A) dopamine receptor | 29 | 6.2 | 5 | MIG1_KLULA (P50898) Regulatory protein MIG1 | 28 | 8.1 |
|---|
>AMPD3_RAT (O09178) AMP deaminase 3 (EC 3.5.4.6) (AMP deaminase isoform E)| Length = 765 Score = 29.6 bits (65), Expect = 3.6 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = +3 Query: 186 RIQGNCLLIYYTQTYTNKRDPQKIPHP 266 R+QG L +Y QT +++P +P+P Sbjct: 221 RMQGGVLFVYDNQTMLERQEPHSLPYP 247
>CLS2_CAEEL (P32744) Kinetochore protein CLASP-2| Length = 1020 Score = 29.3 bits (64), Expect = 4.7 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = -1 Query: 428 KSFVPYLEGLSSTQLRLVTIYANRISQARS 339 K+ P+L+ LSS +L LV +Y NR + S Sbjct: 987 KTMEPHLQNLSSGKLNLVQVYVNRAMSSSS 1016
>KR74_ICHV1 (Q00095) Gene 74 protein kinase (EC 2.7.11.1)| Length = 673 Score = 28.9 bits (63), Expect = 6.2 Identities = 12/27 (44%), Positives = 14/27 (51%) Frame = +2 Query: 185 PNTRELFAYILYTNLHKQTGPPKNPTP 265 P REL Y Y LH+ +GP P P Sbjct: 393 PTARELLVYPRYATLHRISGPGPAPPP 419
>DRD1_DIDMA (P42288) D(1A) dopamine receptor| Length = 446 Score = 28.9 bits (63), Expect = 6.2 Identities = 12/30 (40%), Positives = 15/30 (50%) Frame = +3 Query: 165 SHKEPNSRIQGNCLLIYYTQTYTNKRDPQK 254 SH EP I +C L+Y RDP+K Sbjct: 375 SHHEPRGSISKDCNLVYLIPQAVTSRDPKK 404
>MIG1_KLULA (P50898) Regulatory protein MIG1| Length = 474 Score = 28.5 bits (62), Expect = 8.1 Identities = 25/75 (33%), Positives = 33/75 (44%) Frame = +2 Query: 23 ALSITLQLLSLYIVT*SYNPRQHTLANTLLSSPLHKLTKKKDKEYIIITQRTKLPNTREL 202 ALS ++ L + SYN Q L + +P LT+ D EYI LP TR Sbjct: 251 ALSSLQRMTPLSQNSESYNHSQQNLVHLHHPAPNRPLTEFVDNEYI----SNGLPRTRS- 305 Query: 203 FAYILYTNLHKQTGP 247 +TNL +Q P Sbjct: 306 -----WTNLSEQQSP 315 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 66,299,100 Number of Sequences: 219361 Number of extensions: 1364532 Number of successful extensions: 4050 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 3944 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4050 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2735358828 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)