Clone Name | rbastl30e11 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | COX3_CANGA (Q85Q96) Cytochrome c oxidase subunit 3 (EC 1.9.3.1) ... | 28 | 6.1 |
---|
>COX3_CANGA (Q85Q96) Cytochrome c oxidase subunit 3 (EC 1.9.3.1) (Cytochrome c| oxidase polypeptide III) (Cytochrome oxidase subunit 3) Length = 269 Score = 28.1 bits (61), Expect = 6.1 Identities = 10/36 (27%), Positives = 19/36 (52%) Frame = -1 Query: 247 STAVYLGHAIRCYQHRRPYNSAGVMIWIVLVFVPRQ 140 +T Y HA+ C + + + IW++++FV Q Sbjct: 150 ATITYSHHALICRNRNKALSGLFITIWLIIIFVTCQ 185 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 38,323,036 Number of Sequences: 219361 Number of extensions: 659793 Number of successful extensions: 1572 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1559 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1572 length of database: 80,573,946 effective HSP length: 65 effective length of database: 66,315,481 effective search space used: 1591571544 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)