Clone Name | rbastl30c11 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | REG3B_MOUSE (P35230) Regenerating islet-derived protein 3 beta p... | 30 | 2.1 | 2 | MATK_PEA (Q5YJU1) Maturase K (Intron maturase) | 28 | 4.6 | 3 | REG3G_RAT (P42854) Regenerating islet-derived protein 3 gamma pr... | 28 | 6.0 |
---|
>REG3B_MOUSE (P35230) Regenerating islet-derived protein 3 beta precursor (Reg| III-beta) (Pancreatitis-associated protein 1) Length = 175 Score = 29.6 bits (65), Expect = 2.1 Identities = 13/38 (34%), Positives = 23/38 (60%) Frame = -3 Query: 279 LLLHEGQGHRRLTDVPSLFIQC*RGAKLFFSYLVLIFR 166 +LL + QG L ++PS I C +G++ + SY +F+ Sbjct: 19 MLLSQVQGEDSLKNIPSARISCPKGSQAYGSYCYALFQ 56
>MATK_PEA (Q5YJU1) Maturase K (Intron maturase)| Length = 506 Score = 28.5 bits (62), Expect = 4.6 Identities = 10/28 (35%), Positives = 18/28 (64%) Frame = -3 Query: 84 FITSSKDVNCSRQDSGKLLIFRHNFILC 1 FIT+ K ++ + + +L +F HNF +C Sbjct: 190 FITTKKSISTFSKSNPRLFLFLHNFYVC 217
>REG3G_RAT (P42854) Regenerating islet-derived protein 3 gamma precursor (Reg| III-gamma) (Pancreatitis-associated protein 3) Length = 174 Score = 28.1 bits (61), Expect = 6.0 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = -3 Query: 279 LLLHEGQGHRRLTDVPSLFIQC*RGAKLFFSYLVLIF 169 +LL + QG DVP+ I C +G++ + SY +F Sbjct: 19 MLLSQVQGEDAKEDVPTSRISCPKGSRAYGSYCYALF 55 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 30,072,817 Number of Sequences: 219361 Number of extensions: 408985 Number of successful extensions: 748 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 743 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 748 length of database: 80,573,946 effective HSP length: 72 effective length of database: 64,779,954 effective search space used: 1554718896 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)