Clone Name | rbastl30c10 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | EMP70_YEAST (P32802) Endosomal P24A protein precursor (70 kDa en... | 28 | 5.2 | 2 | RAS2_NEUCR (Q01387) Protein ras-2 | 28 | 5.2 | 3 | RPOA_SHFV (Q68772) Replicase polyprotein 1ab (ORF1ab polyprotein... | 27 | 8.9 |
---|
>EMP70_YEAST (P32802) Endosomal P24A protein precursor (70 kDa endomembrane| protein) (Pheromone alpha-factor transporter) (Acidic 24 kDa late endocytic intermediate component) Length = 667 Score = 28.1 bits (61), Expect = 5.2 Identities = 15/35 (42%), Positives = 20/35 (57%) Frame = -1 Query: 169 TCLTLNRIFFPHRFAFFSCLLRYTHICLQSVLITF 65 T L N+IF+ F FFS LL L ++LIT+ Sbjct: 549 TSLWFNKIFYMFGFLFFSFLLLTLTSSLVTILITY 583
>RAS2_NEUCR (Q01387) Protein ras-2| Length = 229 Score = 28.1 bits (61), Expect = 5.2 Identities = 14/34 (41%), Positives = 22/34 (64%) Frame = +1 Query: 52 LQLCRM*LKHFEGKYVCT*EDN*RKQIYVEKKSC 153 +QLC L+HF Y T ED+ RKQ+ ++ ++C Sbjct: 26 IQLC---LEHFVETYDPTIEDSYRKQVVIDGQAC 56
>RPOA_SHFV (Q68772) Replicase polyprotein 1ab (ORF1ab polyprotein) [Includes:| Replicase polyprotein 1a (ORF1a)] [Contains: Nsp1-alpha papain-like cysteine proteinase (EC 3.4.22.-) (PCP1-alpha); Nsp1-beta papain-like cysteine proteinase (EC 3.4.22.-) (PCP1 Length = 3596 Score = 27.3 bits (59), Expect = 8.9 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = -2 Query: 405 CWIHACFPHGWCSKAASQI*PILTSHPVSCPA 310 C++ AC HGWCS S+ H V C A Sbjct: 720 CFVEAC-AHGWCSSLLSEPTGEEGEHLVDCSA 750 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 63,322,010 Number of Sequences: 219361 Number of extensions: 1228772 Number of successful extensions: 2337 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2303 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2337 length of database: 80,573,946 effective HSP length: 110 effective length of database: 56,444,236 effective search space used: 1354661664 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)