Clone Name | rbastl30b07 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | ZN563_HUMAN (Q8TA94) Zinc finger protein 563 | 29 | 4.9 | 2 | PK1_NPVOP (O10269) Serine/threonine-protein kinase 1 (EC 2.7.11.1) | 29 | 4.9 | 3 | MEIS1_MOUSE (Q60954) Homeobox protein Meis1 (Myeloid ecotropic v... | 28 | 8.4 | 4 | MEIS1_HUMAN (O00470) Homeobox protein Meis1 | 28 | 8.4 |
---|
>ZN563_HUMAN (Q8TA94) Zinc finger protein 563| Length = 476 Score = 29.3 bits (64), Expect = 4.9 Identities = 18/60 (30%), Positives = 27/60 (45%), Gaps = 3/60 (5%) Frame = +2 Query: 110 KSFTCH---QQEPLPRSGQEIRCC*CCGNRYQSKDNRLLHMAALQQQHDPNEDGTRPHKC 280 K+F+ H Q P +G++ C CG + S+ N HM + G RP+KC Sbjct: 148 KAFSYHHSFQSRGRPHTGKKRYECKECGKTFSSRRNLRRHMVV--------QGGNRPYKC 199
>PK1_NPVOP (O10269) Serine/threonine-protein kinase 1 (EC 2.7.11.1)| Length = 274 Score = 29.3 bits (64), Expect = 4.9 Identities = 17/58 (29%), Positives = 26/58 (44%) Frame = +2 Query: 242 HDPNEDGTRPHKCLRVMAAIVEVRFCYSRDSSWHQVSSFSAYLPTPVLNSDLNVKSAL 415 H + D H + + V++ FCYS ++W V Y+P P L L + AL Sbjct: 51 HSFSADEINVHDLMSDHPSFVDMYFCYSSPTAWAIVMD---YVPCPDLFETLQTQGAL 105
>MEIS1_MOUSE (Q60954) Homeobox protein Meis1 (Myeloid ecotropic viral| integration site 1) Length = 390 Score = 28.5 bits (62), Expect = 8.4 Identities = 13/26 (50%), Positives = 18/26 (69%) Frame = -2 Query: 455 SHQSNGTSGPAAG*GHSSHLDQNSEQ 378 S +S GT GP++G GH+SH NS + Sbjct: 222 STRSGGTPGPSSG-GHTSHSGDNSSE 246
>MEIS1_HUMAN (O00470) Homeobox protein Meis1| Length = 390 Score = 28.5 bits (62), Expect = 8.4 Identities = 13/26 (50%), Positives = 18/26 (69%) Frame = -2 Query: 455 SHQSNGTSGPAAG*GHSSHLDQNSEQ 378 S +S GT GP++G GH+SH NS + Sbjct: 222 STRSGGTPGPSSG-GHTSHSGDNSSE 246 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 60,351,051 Number of Sequences: 219361 Number of extensions: 1075386 Number of successful extensions: 2506 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2448 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2506 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2851757076 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)