Clone Name | rbastl30b02 |
---|---|
Clone Library Name | barley_pub |
No. | Definition | Score (bits) |
E Value |
1 | Y163_SYNY3 (Q55563) Hypothetical WD-repeat protein sll0163 | 30 | 4.1 |
---|
>Y163_SYNY3 (Q55563) Hypothetical WD-repeat protein sll0163| Length = 1693 Score = 29.6 bits (65), Expect = 4.1 Identities = 15/31 (48%), Positives = 22/31 (70%) Frame = -2 Query: 334 NVERERETLLRSAIVYPLVCLLLAVKI*GQD 242 N+E++ + +L+ +VYPL LL AVK GQD Sbjct: 942 NLEKQCQFILKQFLVYPLEALLAAVKT-GQD 971 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 52,556,215 Number of Sequences: 219361 Number of extensions: 776222 Number of successful extensions: 1316 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1303 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1316 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3072927439 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)